SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006790 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006790
Domain Number 1 Region: 404-626
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-56
Family DBL homology domain (DH-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 190-323
Classification Level Classification E-value
Superfamily BRCT domain 2.47e-23
Family DNA topoisomerase II binding protein 1, TopBP1 0.055
Further Details:      
 
Domain Number 3 Region: 107-219
Classification Level Classification E-value
Superfamily BRCT domain 8.92e-19
Family DNA ligase 0.028
Further Details:      
 
Domain Number 4 Region: 617-762
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000169
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006790   Gene: ENSNLEG00000005565   Transcript: ENSNLET00000007131
Sequence length 927
Comment pep:novel supercontig:Nleu1.0:GL397268.1:26390578:26456547:1 gene:ENSNLEG00000005565 transcript:ENSNLET00000007131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENSVLTSTTGRTSLADSSIFDCKVTEMSKENLLIGSTSYVEEEMPQIETRVILVQEAG
KQEELIKALKDIKVGFVKMESVEEFEGLDSPEFENVFVVTDFQDSVFDDLYKADCRVIGP
PVVLNCSQKGEPLPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDFN
SKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQDFCAAVDDFRNEFKVPPF
QDCILSFLGFSDEEKTNMEEMTEMQGGKYLPLGDERCTHLVVEENIIKDLPFEPSKKLYV
VKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSMLSLNTPNSNRKRRRLKETLAQLS
RETDVSPFPPRKRPSAEHSLSIGSLLDISNTPESSINYGDTPKSCTKSSKNSTPVPSKQS
ARWQVAKELYQTESNYVNILATIIQLFQIPLEEEGQRGGPILAPEEIKTIFGSIPDIFDV
HTKIKDDLEDLIVNWDESKSIGDIFLKYSKDLVKTYPPFVNFFEMSKETIIKCEKQKPRF
HAFLKINQAKPECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSL
KEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETISLGEHPCDRGEQ
VTLFLFNDCLEIARKRHKVIGTFRSPHGQTRPPASLKHIHLMPLSQIKKVLDIRETEDCH
NAFALLVRPPTEQANVLLSFQMTSDELPKENWLKMLCRHVANTICKADAENLIYTADPES
FEVNTKDMDSTLSRASRAIKKTSKKVTRAFSFSKTPKRALRRALMTSHSSVEGRSPSSND
KHVMSRLSSTSSLAITHSVSTSSVIGFTKHVHVQRPNSTGGRSQYSWFQSVRHSAFLASF
SEILEGNTDCSNFKKVPSKSSLTFVKN
Download sequence
Identical sequences ENSNLEP00000006790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]