SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006833 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006833
Domain Number 1 Region: 7-189
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-34
Family DBL homology domain (DH-domain) 0.00061
Further Details:      
 
Domain Number 2 Region: 189-357
Classification Level Classification E-value
Superfamily PH domain-like 8.4e-25
Family Pleckstrin-homology domain (PH domain) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006833   Gene: ENSNLEG00000005642   Transcript: ENSNLET00000007175
Sequence length 379
Comment pep:novel supercontig:Nleu1.0:GL397276.1:28324772:28362531:1 gene:ENSNLEG00000005642 transcript:ENSNLET00000007175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFMNTLKYLQTHEYLLDVDLWRLFANLEELTQTSLGFVKSLFGIIKDYVDASEVSSSLD
FISVLTKYFRGSLCQSHQTYCLNYSAAIFYLESLRQRDDFGIYLKWCEQNEQCRRLHLPE
LLVAPLQRLTRYPLLLKNIWKRSMDSAEKIMIYSIKEKVEKSIRDFEGKVKWLDNFQKFR
YLQEIIVWPPLWDRDKRFFIPECLKHIFKEQTAENILSPTNRHLLYEGKLTLAESTRFLD
VYLFLFNDFLLVTKTKRNKKKLGGSDPGLMCPSFTPELQAVIKDGGSCTVLDQPIPLDRL
VVKNIEPLHVSVFGLRNAFLIQHENRYRQCTAAFLLRAQTENIKKTWMAQITTAISCFTR
SQETKKISLFTLPAESSEI
Download sequence
Identical sequences ENSNLEP00000006833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]