SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006850 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006850
Domain Number 1 Region: 144-675,805-999
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.89e-260
Family Motor proteins 0.00000000193
Further Details:      
 
Domain Number 2 Region: 1693-1882
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.49e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 3 Region: 18-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000101
Family Ras-binding domain, RBD 0.027
Further Details:      
 
Domain Number 4 Region: 1000-1048
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000584
Family Motor proteins 0.024
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000006850
Domain Number - Region: 1623-1662
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000715
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006850   Gene: ENSNLEG00000005632   Transcript: ENSNLET00000007192
Sequence length 2156
Comment pep:novel supercontig:Nleu1.0:GL397382.1:2352418:2467413:1 gene:ENSNLEG00000005632 transcript:ENSNLET00000007192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVKEAGSSGRREQAAYHLHIYPQLSTTESQASCCVTATKDSTTSDVIKDAIASLRLDGT
KCYVLVEVKESGGEEWVLDANDSPVHRVLLWPRRAQDEHPQEDGYYFLLQERNADGTIKY
VHMQLVAQATATRRLVERGLLPRQQADFDDLCNLPELTEGNLLKNLKHRFLQQKIYTYAG
SILVAINPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVAYYTMLRKRVNQCIVISGE
SGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVSYLESGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEERQEFQLKQPED
YFYLNQHNLKIEDGEDLKHDFERLKQSMEMVGFLPATKKQIFAVLSAILYLGNVTYKKRA
TGREEGLEVGPPEVLDTLSQLLKVKREILVEVLTKRKTVTVNDKLILPYSLSEAITARDS
MAKSLYSALFDWIVLRINHALLNKKDVEEAVSCLSIGVLDIFGFEDFERNSFEQFCINYA
NEQLQYYFNQHIFKLEQEEYQGEGITWHNIGYTDNVGCIHLISKKPTGLFYLLDEESNFP
HATSQTLLAKFKQQHEDNKYFLGTPVMEPAFIIQHFAGKVKYQIKDFREKNMDYMRPDIV
ALLRGSDSSYVRELIGMDPVAVFRWAVLRAAIRAMAVLREAGHLRAERAEKAAGGSRGGC
GSHPRSMLIGLSLPHSWDYSDLHNQMIKSIKGLPWQGEDPRSLLQSLSRLQKPRAFILKS
KGIKQKQIIPKNLLDSKSLKLIISMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLE
ALGKAEPFFIRCIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTE
QFQVLLPNDAQPCREVISTLLEKMKIDKRNYQIGKTKVFLKETERQALQETLHREVVRKI
LLLQSWFRMVLERRHFLQMKRAAVTIQACWRSYRVRRALERTQAAVYLQAAWRGYWQRKL
YRRQKQSIIRLQSLCRGHLQRKSFSQMISEKQKAEEKEREALEAARAGAEEGRLGQAAGG
QQVAEQEPEPAEDGGHLASEPEVQPSDRSPLEHSSPEKEAPSPEKTLPPQKTVAAESHEK
VPSSREKRESRRQRGLEHVKFQNKHIQSCKEESALREPSRRVTQEQGVSLLEDKKDSRED
ETLLVVETEAENTSQKQPTEQPQAMAVGTVSEETEKTLPSGSPRPGQLERPTSLALDSRV
SPPAPGSAPETPEDKSKPCGSPRVQEKPDSPGGSTQIQRYLDAERLASAVELWRGKKLVA
TASPSAMLSQSLDLSDRHRATGAALTPTEERRTSFSTSDVSKLLLSPAKAQPAAETTDGE
RSAKKPAVQKKKSGDASSLPDAGLSPGSQVDSKSTFKRLFLHKTKDKKYSLEGAEELENA
VSGQAVLEATTMKKGLEVPSGQQQRHAAGEKRTKEPGGKGKKNRNVKIGKITVSEKWRES
FRQITNANELKYLDEFLLNKINDLRSQKTPIESLFIEATEKFRSNIKTMYSVPNGKIHVG
YKDLMENYQIVVSNLATERGQKDTNLVLNLFQSLLDEFTRGYTKNDFEPVKQSKAQKKKR
KQERAVQEHNGHVFASYQVSIPQSCEQCLSYIWLMDKALLCSGDHIPPPQTIHHHPRGRA
QFSADPKGEPGAEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAAN
RTRELRQALQTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEKQ
EQLAAIYAVLEHLPEANHNSLERLIFHLLAVALLEDVNRMSPGALAIIFAPCLLRCPDNS
DPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPLK
LGFSSPYEAVLNKSPKARDSQGEELEVLLEEEAAGGDEDREKEILIERIQSIKEEKQDIT
YRLPELDPRGSDEENLDSETSASTESLLEERAGRGASEGPPAPALPCPGAPAPSPLPTVA
APPRRRPSSFVTVRVKTPRRTPIMPTANIKLPPGLPSHLPCWAPGAREAAAPVRRREPPA
RRPDQIHSVYITPGADLPMQGALEPLEEDGQPPGAKRRYSDPPTYCLPPASGQANG
Download sequence
Identical sequences ENSNLEP00000006850 ENSNLEP00000006850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]