SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007021 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007021
Domain Number 1 Region: 7-123
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.59e-16
Family FHA domain 0.0022
Further Details:      
 
Domain Number 2 Region: 296-342
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000554
Family PHD domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007021   Gene: ENSNLEG00000005795   Transcript: ENSNLET00000007370
Sequence length 345
Comment pep:novel supercontig:Nleu1.0:GL397342.1:7999179:8006051:1 gene:ENSNLEG00000005795 transcript:ENSNLET00000007370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPCFQLLRIGGGRGGDLYTFHPPAGAGCTYRLGHRADLCDVALRPQQEPGLISGIHAEL
HAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFM
FQQVRVKPQDFAAITIPRSRGEARVGAGFRPMLPSLGAPQRPLSTLSPAPKATLILNSIG
SLSKLQPQPLTFSPSWGGPKGLPVPTPPGEVGTTPSAPPQRNRRKSVHRVLAELDDESEP
PENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYPVSAPMAPPAVGGGEPCAAPCCCLP
QEETVAWVQCDGCDIWFHVACVGCSIQAAREADFRCPGCRAGIQT
Download sequence
Identical sequences G1R1E9
ENSNLEP00000007021 ENSNLEP00000023627 ENSNLEP00000007021 XP_003272124.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]