SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007178 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007178
Domain Number 1 Region: 264-459
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000451
Further Details:      
 
Domain Number 2 Region: 14-149
Classification Level Classification E-value
Superfamily SH2 domain 3.23e-27
Family SH2 domain 0.000000381
Further Details:      
 
Domain Number 3 Region: 197-258
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.04e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007178   Gene: ENSNLEG00000005923   Transcript: ENSNLET00000007535
Sequence length 459
Comment pep:novel supercontig:Nleu1.0:GL397263.1:18604554:18821848:-1 gene:ENSNLEG00000005923 transcript:ENSNLET00000007535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTLFDTDEYRPPVWKSYLYQLQQEAPHPRRITCTCEVENRPKYYGREFHGMISREAAD
QLLIVAEGSYLIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTDG
LITLYIETKAAEYIAKMTINPIYEHIGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVS
EKRLTSLVRRATLKENEQIPKYEKIHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCG
LNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSE
GLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDLPIPLITYDAY
PKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKRVTLHEKENLMNAENLGI
VFGPTLMRSPELDAMAALNDIRYQRLVVELLIKNEDILF
Download sequence
Identical sequences A0A096N3U5 A0A2I3HQR3 A0A2J8VR51 A0A2K5CV31 A0A2K5IAK1 A0A2K5MMT3 A0A2K5QRT8 A0A2K5TZQ2 A0A2K6N3H5 F7ESU8
ENSNLEP00000007178 9544.ENSMMUP00000028709 ENSMMUP00000028709 ENSNLEP00000007178 XP_005573587.1.63531 XP_007963600.1.81039 XP_007963601.1.81039 XP_009236122.1.23681 XP_011799382.1.43180 XP_011902441.1.92194 XP_012294611.1.9421 XP_014965886.1.72884 XP_017393751.1.71028 XP_017393752.1.71028 XP_017712448.1.44346 ENSMMUP00000028709 ENSPANP00000007036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]