SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007337 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007337
Domain Number 1 Region: 593-794
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.07e-38
Family DBL homology domain (DH-domain) 0.00000426
Further Details:      
 
Domain Number 2 Region: 808-935
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-26
Family Pleckstrin-homology domain (PH domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 293-398
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000108
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 75-169
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000301
Family CRAL/TRIO domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007337   Gene: ENSNLEG00000006037   Transcript: ENSNLET00000007701
Sequence length 1089
Comment pep:novel supercontig:Nleu1.0:GL397268.1:37216045:37424083:-1 gene:ENSNLEG00000006037 transcript:ENSNLET00000007701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEIMQQEVRPLMAVEIIEQLHRQFAILSGGRGEDGAPIITFPEFSGFKHIPDEDFLNVMT
YLTSIPSVEAASIGFVVVIDRRRDKWSSVKASLTRIAVAFPGNLQLIFILRPCRFIQRTF
TDIGIKYYRNEFKTKVPIIMVNSVSDLHGYIDKSQLTRELGGTLEYRHGQWVNHRTAIEN
FALTLKTTAQMLQTFGACLATTELPRSMLSTEDLLMSHTRQRDKLQDELKLLGKQGTTLL
SCIQEPATKYPNSKLNLNQLENVTTMERLLVQLDETEKAFSQFWSEHHLKLNQCLQLQHF
EHDFCKAKLALDNLLEEQAEFTGIGDSVMHVEQLLKEHKKLEEKSQEPLEKAQLLALIGD
QLIQSHHYAADAIRPRCVDLRHLCDDFINGNKKKWDILGKSLEFHRQLDKVSQWCEAGIY
LLASQAVDKCQSREGVDIALNDIATFLGTVKEYPLLSPEEFYNEFELLLTLDVKAKAQKV
LQRLDDVQEIFHKRQVSLMKLAAKQTRPVQPVAPHPESSPKWVSSKTSQPSTSVPLAPPL
RPSEEHYTETELNSRGKEDDETKFEVKNEEIFESCHERGNPELEQQARLGDLSPRRRVIR
DLLETEEIYIKEIKSIIDGYITPMDFIWLKHLIPDVLQNNKDFLFGNIRELYEFHNRTFL
KELEKCAENPELLAHCFLKRKEDLQIYFKYHKNLPRAKAIWQECQDCAYFGVCQRQLDHN
LPLFKYLKGPSQRLIKYQMLLKGLLDFKSPEDMEIDPAELGGSAKDRPKRTKDSAFSAEL
QQALAVIEDLIKSCELAVDLAAVTECPDDIGKLGKLLLHGPFSVWTIHKDRYKMKDLIRF
KPSQRQIYLFERGIVFCKIRMEPGDQGLSPHYSFKKAMKLMTLSIRQLGRGSHRKFEIAN
RNGLEKYILQAASKEIRDCWFSEISKLLMEQQNNIKDQGNPQFEMSTSKGNGAGCGPWIE
NMERATTSKEDPASSTGGIKGCSSREFSSMDTFEDCEGAEDMEKESSALSLAGLFQSDDS
HETCSSKSAFLERGESSQGEKEERDEEETATRSTEEERAGASTGRLAPAGATAGFQARAL
RPRTSAQES
Download sequence
Identical sequences ENSNLEP00000007337 ENSNLEP00000007337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]