SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007510 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007510
Domain Number 1 Region: 610-1051
Classification Level Classification E-value
Superfamily RNI-like 7.33e-94
Family 28-residue LRR 0.00000202
Further Details:      
 
Domain Number 2 Region: 12-92
Classification Level Classification E-value
Superfamily DEATH domain 4.24e-23
Family Pyrin domain, PYD 0.0032
Further Details:      
 
Domain Number 3 Region: 207-382
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000074
Family G proteins 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007510   Gene: ENSNLEG00000006179   Transcript: ENSNLET00000007878
Sequence length 1061
Comment pep:novel supercontig:Nleu1.0:GL397276.1:36596217:36625080:-1 gene:ENSNLEG00000006179 transcript:ENSNLET00000007878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPTTGRDGLCRLSTYLEELEAVELKKFKLYLGTVTELGEGKIPWGRMETAGPLEMAQLL
ITHFGPEEAWRLALSTFERMNRKDLWERGQREDLVRDTPRGGPSAPGNQSTCLLEVSLVT
PRKDPQETYRDYVRRKFRLMEDRNARLGECVNLSHRYTRLLLVKEHSNPMQAQQQLLDTG
RGHARTVGHQASPIKIETLFEPDEERPEPPRTVVMQGAAGIGKSMLAHKMMLDWADGKLF
QGRFDYLFYISCREMNQSATEGSMQDLISSCWPEPSAPLQELVRVPERLLFIIDGFDELK
PSFHDPQGPWCLCWEEKRPTELLLNSLIRKKLLPELSLLITTRPTALEKLHRLLEHPRHV
EILGFSEAERKEYFYKYFHDAEQAGQVFNYVRDKEPLFTMCFVPLVCWVVCTCLQQQLEG
GGLLRQTSRTTTAVYMLYLLSLMQPKPGTPRLQPPPNQRGLCSLAADGLWNQKILFEEQD
LRKHGLDGADVSAFLNMNIFQKDINCERYYSFIHLSFQEFFAAMYYILDEGERRAGPDQD
VTRLLTEYAFSERSFLALTSRFLFGLLNEETRSHLEKSLCWKVSRHIKMDLLRWIQSKAQ
SDGSTLQQGSLEFFSCLYEIQEEEFIQQALSHFQVIVVSNIASKMEHMVSSFCVKHCRSA
QVLHLYGATYCADGEDRARCSAGAHTLLVQLPERTILLDAYSEHLAAALCTNPNLIELSL
YRNALGSRGVKLLCQGLRHPNCKLQNLRLKRCRISSSACEDLSAALIANKNLTRMDLSGN
GVGFPGMTLLCEGLRHPQCRLQMIQLRKCQLESGACQEMASVLSTNPHLVELDLTGNALE
DLGLRLLCQGLRHPICKLQILWLKICHLTAAACEELASTLSVNQSLRELDLSLNELGDAG
VLLLCEGLQHPMCKLQTLRLGICRLGSAACEGLSAVLQANHNLRELDLSFNDLGNRGLWL
LAEGLQHPACKLQKMWLDSCGLTAKACKNLYFTLGINQTLTHLYLTNNALGDTGVRLLCK
RLSHPGCKLRVLWLFGMDLNKMTHSRLAALRVTKPYLDIGC
Download sequence
Identical sequences XP_003259781.1.23891 ENSNLEP00000007510 ENSNLEP00000007510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]