SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007555 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007555
Domain Number 1 Region: 346-662
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.02e-87
Family Protein kinases, catalytic subunit 0.0000000307
Further Details:      
 
Domain Number 2 Region: 169-284
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.56e-37
Family Synaptotagmin-like (S variant) 0.00000985
Further Details:      
 
Domain Number 3 Region: 25-86
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.64e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0021
Further Details:      
 
Domain Number 4 Region: 96-153
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.78e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007555   Gene: ENSNLEG00000006202   Transcript: ENSNLET00000007924
Sequence length 697
Comment pep:novel supercontig:Nleu1.0:GL397276.1:36670202:36693866:1 gene:ENSNLEG00000006202 transcript:ENSNLET00000007924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGVSPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
Download sequence
Identical sequences G1R2Y3
XP_003259784.1.23891 ENSNLEP00000007555 ENSNLEP00000007555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]