SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007673 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007673
Domain Number 1 Region: 528-739
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-42
Family BCR-homology GTPase activation domain (BH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 93-207
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000000994
Family FCH domain 0.039
Further Details:      
 
Domain Number 3 Region: 474-523
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000471
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007673
Domain Number - Region: 250-352
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00188
Family FCH domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007673   Gene: ENSNLEG00000006312   Transcript: ENSNLET00000008042
Sequence length 952
Comment pep:novel supercontig:Nleu1.0:GL397382.1:4876586:4908150:-1 gene:ENSNLEG00000006312 transcript:ENSNLET00000008042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAEPGLPPAPEGRKRYSDIFRSLDNLEISLENVTLEMLAGDPLLSEDPEPDKTPTATV
TNEASCWSDPSPEGPVPLTGKELDLRLIRTKGGVDAALEYAKTWSRYAKELLAWTEKRAS
YELEFAKSTMKIAEAGKVSIQQQSHMPLQYIYTLFLEHDLSLGALAMETVAQQKRDYYQP
LAAKRTEIEKWRKEFKEQWMKEQKRMVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XPRPWPPVSQAQEAEALYQACVREANARQQDEIAKKRIVSHVRKLVFQGDEVLRRVTLSL
FGLRGAQAERGPRAFAALAECCAPFEPGQRYQEFVRALRPEAPPPAFSFQEFVPSANSSP
LDIRKKLSGPLPPRLDENSAEPGPWEDPGTGWRWQGTPGPTPGSDVDSVGGSSESRSLDS
PTSSPGAGTRRLVKASSTGTESSDDFEERDPDLGDGLENGLGSPFRKWTLSSAAQTHRLR
RLRGPAKCRECEAFMVSGTECEECFLTCHKRCLETLLILCGHRRLPARTPLFGVDFLQLP
RDFPEEVPFVVTKCTAEIEHRALDVQGIYRVSGSRVRVERLCQAFENGRALVELSGNSPH
DVSSVLKRFLQELTDPVIPFHLYDAFISLAKTHADPGDDPGTPSPSPEVIRSXKALRSDL
VAINHARLRPALASIPRVAARFMENKMSANNLGIVFGPTLLRPLDGPRGAGAIPVTCLLD
SGHQAQLVEFLIVHYEQIFGMDELPQATEPPPQDSSPAPGPLTTSSQLPPLHLDPESQPP
VLASDPGPDPQHHSTLEQHPTAMPTEIPTPQSDQREDVAEDTKDGGGEVSSQGPEDSLLG
TQSRGHFSRQPVKYPRGGVRPVTHQLSSLALVASKLCEETPITSVPRGSLRRRGPSPAAA
SPEGSPLRRTPLPKHFEITQETARLLSKLYSEAVPRATCCPDIQAEEAEDHL
Download sequence
Identical sequences ENSNLEP00000007673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]