SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007866 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007866
Domain Number 1 Region: 184-347
Classification Level Classification E-value
Superfamily RNI-like 1.44e-45
Family 28-residue LRR 0.000000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007866   Gene: ENSNLEG00000006457   Transcript: ENSNLET00000008241
Sequence length 352
Comment pep:novel supercontig:Nleu1.0:GL397306.1:12883848:12964529:1 gene:ENSNLEG00000006457 transcript:ENSNLET00000008241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPFRKDLEKYKDLDEDELLGNLSETELKQLETVLDDLDPENALLPAGFRQKNQTSKST
TGPFDREHLLTYLEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELE
EALTSASDTELCDLAAILGMHNLITNTQFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEP
PNPTNVEESLKRIKENDAHLVEVNLNNIKNIPIPTLKDFAKALETNTHVKCFSLAATRSN
DPVATAFAEMLKVNKTLKSLNVESNFITGVGILALIDALRDNETLAELKIDNQRQQLGTA
VELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGDHQ
Download sequence
Identical sequences G1R3U4
ENSNLEP00000007866 XP_003266985.1.23891 XP_012362880.1.23891 ENSNLEP00000007866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]