SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007968 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007968
Domain Number 1 Region: 431-772
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.98e-55
Family Diacylglycerol kinase-like 0.016
Further Details:      
 
Domain Number 2 Region: 4-91,156-183
Classification Level Classification E-value
Superfamily EF-hand 1.86e-38
Family EF-hand modules in multidomain proteins 0.0055
Further Details:      
 
Domain Number 3 Region: 159-265
Classification Level Classification E-value
Superfamily EF-hand 3.07e-18
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number 4 Region: 245-322
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000778
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0048
Further Details:      
 
Domain Number 5 Region: 324-384
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000269
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007968   Gene: ENSNLEG00000006537   Transcript: ENSNLET00000008350
Sequence length 791
Comment pep:novel supercontig:Nleu1.0:GL397268.1:40168172:40383544:-1 gene:ENSNLEG00000006537 transcript:ENSNLET00000008350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEERWVSLTPEEFDQLQKYSEYSSKKIKDVLTEFNEGGSLKQYDPHEPISYDVFKLFMR
AYLEVDLPQPLSTHLFLAFSQKPRQETSDHPTEGASNSEANSPDTNTQNADNATKADEAC
APDTESIMAEKQAPTEDQVAATPLEPPVPRSSSLESPMVYLKDVVCYLSLLETGRPQDKL
EFMFRLYDSDENGLLDQAELDCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFV
SLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHAWTMKHFKKPTYCNFCHIMLMGVRKQGL
CCTYCKYTVHERCVSKNIPGCVKTYSKTKRSGEVMQHAWVEGNSSVKCDRCHKSIKCYQS
VTARHCVWCRMTFHRKCELSTLCDGGELRDHILLPTSICPVTRDKPGGKSDGCVSAKGEL
VMQYKIIPTPGTHPLLVLVNPKSGGRQGERILRKFHYLLNPKQVFNLDNGGPTPGLNFFR
DTPDFRVLACGGDGTVGWILDCIDKANFAKHPPVAVLPLGTGNDLARCLRWGGGYEGGSL
TKILKDIEQSPLVMLDRWHLEVIPREEVENGDQVPYSIMNNYFSIGVDASIAHRFHVMRE
KHPEKFNSRMKNKLWYFEFGTSETFAATCKKLHDHIELECDGVGVDLSNIFLEGIAILNI
PSMYGGTNLWGENKKNRAVIRESRKGVTDPKELKFCVQDLSDQLLEVVGLEGAMEMGQIY
TGLKSAGRRLAQCSSVTIRTNKLLPMQVDGEPWMQPCCTIKITHKNQAPMMMGPPQKSSF
FSLRRKSRSKD
Download sequence
Identical sequences G1R446
XP_003256648.1.23891 ENSNLEP00000007968 ENSNLEP00000007968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]