SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007991 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007991
Domain Number 1 Region: 1222-1276
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.87e-17
Family Synaptotagmin-like (S variant) 0.055
Further Details:      
 
Domain Number 2 Region: 1117-1152
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000115
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007991   Gene: ENSNLEG00000006571   Transcript: ENSNLET00000008375
Sequence length 1276
Comment pep:novel supercontig:Nleu1.0:GL397306.1:15159968:15421158:1 gene:ENSNLEG00000006571 transcript:ENSNLET00000008375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVANFFKSLILPYIHKLCKGMFIKKLGNTNKNKEYRQQKRDQDFPTAGQTKSPKFSYTFK
STVKKIAKCSSTHNLSTKEDEASKEFSLSPTFSYRVAIANGLQKNAKVTNSDNEDLLQEL
SSIESSYSESLNELRSSTENQAQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHGLKLGA
LRKLRKWKKSQECVSSDSELSTMKKSWGIRSKSLDRTVRNPKTNALEPGFSSSGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
ETRDIHDYIKHLGHMGSKASLRFLNVPEERFEYVESVVYQILIDKMGFSDAPNAIKIEFA
QRIGHQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGVSTDILTHDIRERKEKG
IPSSQTYESMDIKLSTPEPKIKKNNWQSPDDSDEDLESDLNRNSYSVLSKSELLTKGGTS
KPSSKSHSARSKNKTANSSRISNKSDYDKISSQLPESDILEKQTTTHYADATPLWHSQSD
FFTAKLSHSESDFSKLCQSYSEDFSENQFFTRTNGSSLLSSSDRELWQRKQEGTATLYDS
PKDQHLNGSVQGIQGQTEIENTETVDSGMSNGMVCASGDQSHYSDSQLSLHEDLSPWKEW
NQVEQGADLGLDSSTQEGFDYETNSLSDQQLGVYNKDLEYLGKCHSDLQDDSESYDLTQD
DNSSPCPGLHNEPQGQWVGQYDSYQGANSNELYQNQNQLSMRYRSQSELQSDDSEDAPPK
SWHSRLSIDLSDKTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLS
QSTANESSTTLDSDVYTEPYYYKAEDEEDYTEPVADNETDYVEVMEQVLAKLENRTSITE
TDEQMQAYDHLSYETPYETPQDEGYDGPADDMVSEEGLEPLNETSAEMEIREDENQNIPE
QPVEITKPKRIRPSFKEAALRAYKKQMAELEEKILAGVATGTKKKARIVSGNDFEASKFS
ALPVCGGAGGGLYGIDSMPDLRRKKTLPIVRDVVTTLAARKSGLSLAMVIRTSLNNEELY
LNTIAVVFLALHYPSLGTEILNFVSIVATKSTFLSYRCEGLLWGIARQGMKCLECGVKCH
EKCQDLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIRERNRPEVFEVIQEMFQIS
KEDFVQYTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRT
KTIFGNLNPVWDEKFY
Download sequence
Identical sequences ENSNLEP00000007991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]