SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008432 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008432
Domain Number 1 Region: 176-289
Classification Level Classification E-value
Superfamily Bromodomain 9.55e-27
Family Bromodomain 0.00056
Further Details:      
 
Domain Number 2 Region: 294-426
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.21e-22
Family PWWP domain 0.008
Further Details:      
 
Domain Number 3 Region: 104-159
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000226
Family PHD domain 0.011
Further Details:      
 
Domain Number 4 Region: 1050-1092
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000401
Family MYND zinc finger 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008432
Domain Number - Region: 948-1038
Classification Level Classification E-value
Superfamily OmpH-like 0.017
Family OmpH-like 0.04
Further Details:      
 
Domain Number - Region: 854-944
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0288
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008432   Gene: ENSNLEG00000006904   Transcript: ENSNLET00000008830
Sequence length 1242
Comment pep:novel supercontig:Nleu1.0:GL397262.1:11064211:11215807:-1 gene:ENSNLEG00000006904 transcript:ENSNLET00000008830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFLEEFEARSCLAEEEIKTEQEVVEGMDISTRSKDPGSAERAAQKRKFPSPPHSSNGHS
PQDTSTSPIKKKKKPGLLNSNNKEQSELRHGPFYYMKQPLTTDPVDVVPQDGRNDFYCWV
CHREGQVLCCELCPRVYHAKCLRLTSEPEGDWFCPECEKITVAECIETQSKAMTMLTIEQ
LSYLLKFAIQKMKQPGTDAFQKPVPLEQHPDYAEYIFHPMDLCTLEKNAKKKMYGCTEAF
LADAKWILHNCIIYNGGNHKLTQIAKVVIKICEHEMNEIEVCPECYLAACQKRDNWFCEP
CSNPHPLVWAKLKGFPFWPAKALRDKDGQVDARFFGQHDRAWVPINNCYLMSKEIPFSVK
KTKSIFNSAMQEMEVYVENIRRKFGVFNYSPFRTPYTPNSQYQMLLDPTNPSAGTAKIDK
QEKVKLNFDMTASPKILMSKPVLSGGTGRRISLSDMPRSPMSTNSSVHTGSDVEQDAEKK
ATSSHFSASEESMDFLDKSTASPASTKTGQAGSLSGSPKPFSPQLSTPITTKTDKTSTTG
SILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGI
NEISEDVYSAVEHSDSEYSEKSNSSDSEYISDDEQKSKNEPEDTEDKEGCRMDKEPSAVK
KKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPTKDKLKGK
DETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTAG
SHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPA
VQRVVWNSSSKFQTSSQKWHMQKMQRQQQQQQQQQNQQQQPQSSQGTRYQTRQAVKAVQQ
KEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSK
MMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEM
RQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQ
AHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAE
KSKDSGSVRIPPCLWLVTSNSEATCAISSVSKRCDKQPAYAPTTTDHQPHPNYPAQKYHS
RSNKSSWSGSDEKRGSTRSEHNTSTSTKSLLPKESRLDTFWD
Download sequence
Identical sequences ENSNLEP00000008432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]