SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008434 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008434
Domain Number 1 Region: 295-437
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 191-296
Classification Level Classification E-value
Superfamily Second domain of FERM 9.16e-37
Family Second domain of FERM 0.00000293
Further Details:      
 
Domain Number 3 Region: 110-190
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-27
Family First domain of FERM 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008434   Gene: ENSNLEG00000006919   Transcript: ENSNLET00000008833
Sequence length 1087
Comment pep:novel supercontig:Nleu1.0:GL397285.1:22285367:22447281:-1 gene:ENSNLEG00000006919 transcript:ENSNLET00000008833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPNEEQQQALEQFAAAAAHSTPVRR
EVTDKEQEFAARAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLDGS
EYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAW
HFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDY
DPDECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDL
HHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFE
STIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRAS
ALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKAEEERDE
EEDKRRKGEEVTPVSAIRHEGKSPGLGTDSCPLSPPSAHCAPTSPTELRRRCKENDGKLP
GYEPSRAEHVPGEPALASDGPGRPYLGDQDVAFSYRQQTGKGTTLFSFSLQLPESFPSLL
DDDGYLSFPSLSETNLLPQSLQHYLPIHSPSLVPCFLFIFFFLLSASFSVPYALTLSFPL
ALCLCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAADGETTATESDQEEDAELKAQE
LEKTQDDLMKHQTNISELKRTFLETSTDTAVTNEWEKRLSTSPVRLAARQEDAPMIEPLV
PEETKQSSGEKLMDGSEIFSLLESARKPTEFIGGVTSTSQSWVQKMETKTESSGIETEPT
MHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAATQPSFTGIKGKEGSALTEG
AKEEGEEEVAKAVLEQEEIAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGS
VSPGGVKLEISTKEVPVVHTETKTITYESSQVDAGTDLEPGVLMSAQTITSETTSTTTTT
HITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI
TPEDGED
Download sequence
Identical sequences G1R5G2
XP_003262107.1.23891 XP_012361814.1.23891 ENSNLEP00000008434 ENSNLEP00000008434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]