SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008516 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008516
Domain Number 1 Region: 1379-1433,1476-1656
Classification Level Classification E-value
Superfamily VPS9 domain 2.62e-41
Family VPS9 domain 0.0021
Further Details:      
 
Domain Number 2 Region: 12-218
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.18e-37
Family Regulator of chromosome condensation RCC1 0.0049
Further Details:      
 
Domain Number 3 Region: 519-687
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.75e-28
Family beta-lactamase inhibitor protein-II, BLIP-II 0.066
Further Details:      
 
Domain Number 4 Region: 1046-1134
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 6.67e-20
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.01
Further Details:      
 
Domain Number 5 Region: 1139-1226
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0000000000000144
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.024
Further Details:      
 
Domain Number 6 Region: 926-1013
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000965
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 7 Region: 692-890
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000995
Family DBL homology domain (DH-domain) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008516   Gene: ENSNLEG00000006980   Transcript: ENSNLET00000008918
Sequence length 1658
Comment pep:novel supercontig:Nleu1.0:GL397263.1:45884273:45968288:-1 gene:ENSNLEG00000006980 transcript:ENSNLET00000008918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKKRSSTEAEGSKERGLVHIWQAGSFPITPERLPGWGGKTVLQAALGVKHGVLLTEDG
EVYSFGTLPWRSGPAEICPSSPILENALVGQYVVTVATGSFHSGAVTDNGVAYMWGENSA
GQCAVANQQYVPEPNPVSIADSEASPLLAVRILQLACGEEHTLALSISREIWAWGTGCQL
GLITTAFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCLPSQDLKPVPERCNQCSQLLI
TMTDKEDHVIISDSHCCPLGVTLTESQAENHASTALSPSAEALDRQEEVFENTLVANDQS
VATELNAVSAQTTSSDAVSSQQNVMGTTEISSARNIPSYPDTQAVSEYLRKLSDHSVRED
SEHGEKPMPSQPLVEEAIPNLHSPPTTSTSALNSLVVSCASAVGVRVAATYEAGALSLKK
VMNFYSTTPYETGAQAGSSAIGPEGLKDSREEQVKQESMQGKKSSSLVDIREEETEGGSR
RLSLPGLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKEGQLG
HGDVLPRLQPLCVKCLDGKEVIHLEAGGYHSLALTAKSQVYSWGSNTFGQLGHSDFPTTV
PRLAKISSENGVWSVAAGQDYSLFLVDTEDFQPGLYYSGRQDPTEGDNLPENHSGSKTPV
LLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSDIKSQILRPL
LSLENLGTTTTVQLLQEVASRFSKLCYLIGQHGASLSSFLHGVKEARSLVILKHSSLFLD
SYTYCTSITNFLVMGGFQLLAKPAIDFLNKNQELLQDLSEVNDENTQLMEILNTLFFLPI
RRLHNYAKVLLKLATCFEVASPEYQKLQDSSSCYECLALHLGRKRKEAEYTLGFWKTFPG
KMTDSLRKPERRLLCESSNRALSLQHAGRFSVNWFILFNDALVHAQFSTHHVFPLATLWA
EPLSEEAGGVNGLKITTPEEQFTLISSTPQEKTKWLRAISQAVDQALRGMSDLPPYGSGS
SVQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSGKPHGRGVKWPDGKMYSGMFRNGLED
GYGEYRIPNKAMNKEDHYVGHWKEGKMCGQGVYSYASGEVFEGCFQDNMRHGHGLLRSGK
LTSSSPSMFIGQWVMDKKAGYGVFDDITRGEKYMGMWQDDVCQGNGVVVTQFGLYYEGNF
HLNKMMGNGVLLSEDDTIYEGEFSDDWTLSGSTAYNLHHPLNFDILYGHFIQFKIFSSFP
CVFFFFYPWIFWSQKKHSQFRKLGNLAVPADEKWKAVFDECWRQLGCEGPGQGEVWKAWD
NIAVALTTSRRQHRDSPEILSRSQTQTLESLEFIPQHVGAFSVEKYDDIRKYLIKACDTP
LHPLGRLVETLVAVYRMTYVGVGANRRLLQEAVKEIKSYLKRIFQLVRFLFPELPDEGST
IPLSAPLPTERKSFCTGKSDSRSESPEPGYVVTSSGLLLPVLLPRLYPPLFMLYALDNDR
EEDIYWECVLRLNKQPDIALLGFLGVQRKFWPATLSILGESKKVLPTTKDACFASAVECL
QQISTTFTPSDKLKVIQQTFEEISQSVLASLQEDFLWSMDDLFPVFLYVVLRARIRNLGS
EVHLIEDLMDPYLQHGEQGIMFTTLKACYYQIQREKLN
Download sequence
Identical sequences ENSNLEP00000008516 ENSNLEP00000008516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]