SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008526 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008526
Domain Number 1 Region: 209-291
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000202
Family Ras-binding domain, RBD 0.036
Further Details:      
 
Domain Number 2 Region: 43-83
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000436
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008526   Gene: ENSNLEG00000006991   Transcript: ENSNLET00000008928
Sequence length 344
Comment pep:novel supercontig:Nleu1.0:GL397269.1:38560810:38572264:-1 gene:ENSNLEG00000006991 transcript:ENSNLET00000008928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGEPELIELRELAPAGRAGQGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCARGRRGQLPRTRSVTFAPSLKMVGSGWAPAMALCPCWP
ILQDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSV
PSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVV
DDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAF
SMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
Download sequence
Identical sequences ENSNLEP00000008526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]