SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008796 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008796
Domain Number 1 Region: 345-669
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.82e-92
Family Protein kinases, catalytic subunit 0.000000000455
Further Details:      
 
Domain Number 2 Region: 2-122
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.65e-24
Family PLC-like (P variant) 0.00000107
Further Details:      
 
Domain Number 3 Region: 217-284
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.64e-23
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000872
Further Details:      
 
Domain Number 4 Region: 141-210
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.73e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008796   Gene: ENSNLEG00000007210   Transcript: ENSNLET00000009214
Sequence length 676
Comment pep:novel supercontig:Nleu1.0:GL397269.1:41319848:41346943:1 gene:ENSNLEG00000007210 transcript:ENSNLET00000009214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFLRIAFNSYELGSLQAEEEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASR
RSDSASSEPVGIYQGFEKKTGVAGEDSQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSF
GKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK
DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVL
LDRDGHIKIADFGMCKENIFGENRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYE
MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIH
PFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAF
AGFSFVNPKFEHLLED
Download sequence
Identical sequences G1R6H4
ENSNLEP00000008796 XP_003257244.1.23891 ENSNLEP00000008796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]