SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008839 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008839
Domain Number 1 Region: 199-339
Classification Level Classification E-value
Superfamily PH domain-like 3.93e-44
Family Third domain of FERM 0.000000176
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.01e-39
Family Second domain of FERM 0.000000579
Further Details:      
 
Domain Number 3 Region: 496-583
Classification Level Classification E-value
Superfamily Moesin tail domain 4.45e-33
Family Moesin tail domain 0.0000222
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-26
Family First domain of FERM 0.00000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008839   Gene: ENSNLEG00000007247   Transcript: ENSNLET00000009259
Sequence length 604
Comment pep:novel supercontig:Nleu1.0:GL397262.1:43422393:43516611:-1 gene:ENSNLEG00000007247 transcript:ENSNLET00000009259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLKQIEEQTVK
AQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPAPPPPPPVIP
PTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARD
ETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAMWGPKLYALFQMRSCQSS
IKQM
Download sequence
Identical sequences G1R6L7
ENSNLEP00000008839 XP_004090619.1.23891 XP_004090620.1.23891 ENSNLEP00000008839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]