SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008840 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008840
Domain Number 1 Region: 136-345
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-54
Family DBL homology domain (DH-domain) 0.0000597
Further Details:      
 
Domain Number 2 Region: 356-479
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008840   Gene: ENSNLEG00000007248   Transcript: ENSNLET00000009260
Sequence length 551
Comment pep:novel supercontig:Nleu1.0:GL397269.1:45071591:45387560:-1 gene:ENSNLEG00000007248 transcript:ENSNLET00000009260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSTAMNQCVCRGMEENKERPKRQRQNNFPMFPSPKAWNFRGRKRKQSTQDEDAVSLCS
LDISEPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWS
RNAAPASTKRRDSKLWSETFDVCVNQMLTSKEIKRQEAIFELSQGEEDLIEDLKLAKKAY
HDPMLKLSIMTEQELNQIFGTLDSLIPLHEELLSQLRDVRKPDGSTEHVGPILVGWLPCL
SSYDSYCSNQVAAKALLDHKKQDHRVQDFLQRCLESPFSRKLDLWNFLDIPRSRLVKYPL
LLREILRHTPNDNPDQQHLEEAINIIQGIVAEINTKTGESECRYYKERLLYLEEGQKDSL
IDSSRVLCCHGELKNNRGVKLHVFLFQEVLVITRAVTHNEQLCYQLYRQPIPVKDLLLED
LQDGEVRLGGSLRGAFSNNERIKNFFRVSFKNGSQSQTHSLQANDTFNKQQWLNCIRQAK
ETVLCAAGQAGVFDSEGSFLNPTTGSRELQGETKLEQMDQSDSESDCSMDTSEVSLDCER
MEQTDSSCGNS
Download sequence
Identical sequences ENSNLEP00000008840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]