SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009013 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009013
Domain Number 1 Region: 666-858
Classification Level Classification E-value
Superfamily RNI-like 2.09e-34
Family 28-residue LRR 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000009013
Domain Number - Region: 154-202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00122
Family Nucleotide and nucleoside kinases 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009013   Gene: ENSNLEG00000007389   Transcript: ENSNLET00000009437
Sequence length 948
Comment pep:novel supercontig:Nleu1.0:GL397262.1:52724278:52738302:1 gene:ENSNLEG00000007389 transcript:ENSNLET00000009437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWGHHLPRASWGSGFRRALQQPDERIPFLMHWSWPLQGRHPLGPPRAFIRHHGSSADST
PPSGRHGRLFPSAFATEAIQRHRRNLAEWFSRLPREERQFGPTFALDTVHVDPVIRESTP
DELLRPPAELALEHQPPQAGLPPLALSQLFNPDACGRRVQTVVLYGTVGTGKSTLVRKMV
LDWCYGRLPAFELLIPFSCEDLSSLGPAPASLCQLVAQRYTPLKEVLPLMAAAGSHLLFV
LHGLERLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPEVGGPLPQAILLPLDSPP
RSWVTLTPGAFTSSSATLSKSVTSPGFCSFLLGHHQIAAACFLPSYCWLVCATLHFLHAP
TPAGQTLTSIYTSFLRLNFSGETLDSTDPSNLSLMAYAARTMGKLAYEGVSSRKTYFSEE
DVCGCLEAGIKTEEEFQLLHIFRRDALRFFLAPCVEPGRAGTFVFTVPAMQEYLAALYIV
LGLRKTTLQKVGKEVAELVGRVGEDVSLVLGIMAKLLPLRALPLLFNLIKVVPQVFGRMV
GKSREAVAQAMVLEMFREEDYYNDDVLDQMGASILGVEGPRRHPDEPPEDEVFELFPMFM
GGLLSAHNRAVLAQLGCPIKNLDALENAQAIKKKLGKLGRQVLPPSELLDHLFFHYEFQN
QRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQLDPAGLHTLMP
VFLRARKLGLQLNSLGPEGCKDLRDLLLHDQCQITTLRLSNNPLTAAGVALLMEGLAGNT
SVTHLSLLHTGLGDEGLELLAAQLDRNRQLQELNVAYNGAGDTAALALARAAREHPSLEL
LHLYFNELSSEGRQVLRDLGGATEGGARVVVSLTEGTAVSEYWSVILSEVQRNLNSWDRA
RVQRHLELLLRDLEDSRGATLNPWRKAQLLRVEGEVRGLLEQLGGSGS
Download sequence
Identical sequences ENSNLEP00000009013 ENSNLEP00000009013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]