SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009028 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009028
Domain Number 1 Region: 370-558
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.58e-66
Family Regulator of G-protein signaling, RGS 0.00000856
Further Details:      
 
Domain Number 2 Region: 767-996
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-64
Family DBL homology domain (DH-domain) 0.000000000662
Further Details:      
 
Domain Number 3 Region: 1000-1130
Classification Level Classification E-value
Superfamily PH domain-like 9.16e-39
Family Pleckstrin-homology domain (PH domain) 0.0000012
Further Details:      
 
Domain Number 4 Region: 69-149
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-22
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009028   Gene: ENSNLEG00000007405   Transcript: ENSNLET00000009455
Sequence length 1544
Comment pep:novel supercontig:Nleu1.0:GL397262.1:53934100:54093072:1 gene:ENSNLEG00000007405 transcript:ENSNLET00000009455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERIASHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVEPSAIGHMSPIMTSPHSPG
ASGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAVVTPSRPLGDTLTVSEAETDPGDGLGRTDCSSGDAS
RPSSDNADSPKSGPKERIYLEENPEKSETIQDTDTQSLVGSPSTRIAPHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRR
IFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDK
SSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDKEGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMELQKARHTKHLSTPSSVSPEPQDSAKLRQSGLANEGTDAGY
LPANSMSSIASGASFSQEGGKENDTGSKQVGEMPAPGDTLDGTPRTLNTVFDFPAPPLDQ
VQEEECEVERVTEHGTPKPFRKFDSVAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKS
RQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKV
KKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKM
IHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTK
PIPLPQSTRGEGDNDEEDPSKLKEEQHGISVTGLQSPDRDLGLESTLMSSKPQSHSLSTS
GKSEVRDLFVAERQFAKEQHTDGTLKEVGEDYQIAIPDSHLPVSEERWALDALRNLGLLK
QLLVQQLGLTEKSTQEDWQHFPRYRTASQGPQTDSVIQSSENIKAYHSGERHMPFRTGTG
DIATCYSPRTSTESSAPRDSVGLAPQDSQASNILVMDHMIMTPEMPTMEPEGGLDDSGEH
FFDAREAHSDENPSEGDGAVNKEEKDVNLRISGNYLILDGYDPVQESSTDEEVASSLTLQ
PMTGIPAVESTHQQQHSPQNTHSDGAISPFTPEFLVQQRWGAMEDSCFEIQSPSSCADSQ
SQIMEYIHKIEADLEHLKKVEESYTILCQRLAGSALTDKHSDKS
Download sequence
Identical sequences A0A2I3HFE2
XP_003253338.1.23891 ENSNLEP00000009028 ENSNLEP00000009028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]