SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009128 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009128
Domain Number 1 Region: 3029-3196
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.24e-65
Family Cyclophilin (peptidylprolyl isomerase) 0.00000072
Further Details:      
 
Domain Number 2 Region: 1145-1277
Classification Level Classification E-value
Superfamily PH domain-like 5.29e-48
Family Ran-binding domain 0.000000306
Further Details:      
 
Domain Number 3 Region: 2284-2414
Classification Level Classification E-value
Superfamily PH domain-like 4.78e-45
Family Ran-binding domain 0.0000428
Further Details:      
 
Domain Number 4 Region: 2879-3017
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-44
Family Ran-binding domain 0.0000306
Further Details:      
 
Domain Number 5 Region: 1986-2117
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-42
Family Ran-binding domain 0.00000113
Further Details:      
 
Domain Number 6 Region: 8-168
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000161
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Domain Number 7 Region: 1639-1665
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000178
Family Ran binding protein zinc finger-like 0.0016
Further Details:      
 
Domain Number 8 Region: 1580-1606
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000178
Family Ran binding protein zinc finger-like 0.0016
Further Details:      
 
Domain Number 9 Region: 1453-1480
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000628
Family Ran binding protein zinc finger-like 0.0017
Further Details:      
 
Domain Number 10 Region: 1389-1416
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000844
Family Ran binding protein zinc finger-like 0.0019
Further Details:      
 
Domain Number 11 Region: 1517-1543
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000377
Family Ran binding protein zinc finger-like 0.0017
Further Details:      
 
Domain Number 12 Region: 1755-1783
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000216
Family Ran binding protein zinc finger-like 0.0017
Further Details:      
 
Domain Number 13 Region: 1698-1724
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000267
Family Ran binding protein zinc finger-like 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000009128
Domain Number - Region: 1328-1354
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0018
Family Ran binding protein zinc finger-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009128   Gene: ENSNLEG00000007501   Transcript: ENSNLET00000009565
Sequence length 3196
Comment pep:novel supercontig:Nleu1.0:GL397543.1:265889:318488:1 gene:ENSNLEG00000007501 transcript:ENSNLET00000009565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYR
RSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGE
DGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSNKRLKDAVAHCHEAEKNIALRSSLEWN
SCVVQTLKEYLESLQCLESDKSDWRATNTDLLLAYANLTLLTLSTRDVQESRELLESFDS
ALQSVKSLGGNDELSATFLEMKGHFYMHASSLLLKMGQHSNVQWRALSELAALCYLIAFP
VPRPKIKLIKGEAGQNLLEMMACDRLSQSGHMLLNLSRGKQDFLKEVVESFANKSGQSAL
YDALFSSQSPKDTSFLGSDDIGNIDVQEPELEDLARYDVGAIRAHNGSLQHLTWLGLQWN
SLPALPGIRKWLKQLFHHLPQETSRLETNAPESICILDLEVFLLGVVYTSYLQLKEKCNS
HHSSYQPLCLPLPVCKQLCTERQKSWWDAVCTLIHRKAVPGNSAKLRLLVQHEINTLRAQ
EKHGLQPALLVHWAKCLQKTGSSLNSFYDQREYIGRSVHYWKKVLPLLKIIKKKNSIPEP
IDPLFKHFHSVDIQASEIVEYEDAHITFAILDAVNGNTEDAMTAFESIKSVVSYWNLALI
FHRKAEDIENDALSPEEQEECKNYLRKTRDYLIKILDDSDSNLSVVKKLPVPLESVKEML
NSVMQELEDYSEGGPLYKNGSLQNADSEIKHSTPSPTKYSLSPSKSYKYSPKTPPRWAED
QNSLLKMICQQVEAIKMESHSVAHDSPASASPVAGITGTRHHAQLIFVFLVDTGFHHVGQ
AVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGPVYGMNRLPPQQHIYAYPQQMHTPPV
QSSSACMFSQEMYGPPALRFESPATGILLPRGDDYFNYNVQQTSTNPPLPEPGYFTKPPI
AAHASRSAESKAIEFGKTNLVQPMPGEGIRPSLPTPAHTTQPTPFKFNSNFKSNDGDFTF
SSPQVVTQPPPAAYSNSESLLGLLTSDKPLQGDGYSGPKPIPGCQNTGPRNTFNFGSKNV
SGISFTENMGSSQQKNSGFRRSDDMFTFHGPGKSVFGTPTLETANKIHETDGGSAHGDDD
DDGPHFEPVVPLPDKIEVKTGEEDEEEFFCNRAKLFRFDVESKEWKERGIGNVKILRHKT
SGKIRLLMRREQVLKICANHYISPDMKLTPNAGSDKSFVWHALDYADELPKPEQLAIRFK
TPEEAALFKCKFEEAQSILKAPGTNVATASNQAVRIVKEPTSLDNKDICKSDAGNMNFEF
QVAKKEGSWWHCNSCSLKNAATAKKCVSCQNLNPSNKELVGPPLAETVFTPKIGPENVQD
RFALVTPKKEGHWDCSICLVRNEPTVSRCIACQNTKSANKSGSSFVHQASFKFGQGDLPK
PVNSDFRSVFSTKEGQWDCSVCLVQNEGSSTKCTACQNPRKQSLPATSIPTPASFKFGTS
ETSKTPKSGFEDMFAKKEGQWDCSSCLVRNEANATRCVACQNPDKPSPSTSVPAPASFKF
GTSETSKAPKSGFEGMFTKKEGQWDCSVCLVRNEASATKCIACQNPGKQNQTTSAILTPA
SSETSKAPKSGFEGMFTKKEGQWDCSVCLVRNEASATKCIACQNPGKQNQTTSAILTPAS
SEKSKAPKSGFEGMFTKKEGQWDRSVCLVRNEASATKCIACQNPGKQNQTTAISTPASSE
ISKAPKSGFEGMFIKKGQWDCSVCCVQNESSSLKCVPCDASKPTNKPIAEAPSAFTLGSE
MKLHDSSGSQVGTGFKSNFSEKAFKFGNTEQGFKFGHVDQENSPSFMFQGSSNTEFKSTK
EGFSIPVSADGFKFGISEPGNQEKKSEKPPENDTGFQAQDISSQKNGSGVIFGQTSSTFT
FADLAKSTSGEGFQFGKKDPNFKGFSGAGEKLFSSQCGKMADKANTSGDFEKDDDAYKTE
DSDDIHFEPVVQMPEKVELVTGEEDEKVLYSQRVKLFRFDAEISQWKERGLGNLKILKNE
VNGKLRMLMQREQVLKVCANHWITTTMNLKPLSGSDRAWMWLASDFSDGDAKLEQLAAKF
KTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFKTFLTN
DQTKVTEEESKSSGTAAAGASDTTIKPNPENTGPTLEWDNHDLREDALDDSVSSSSVHAS
PLASSPVRKNLFRFGESTTGFNFSFKSALSPSKSPAKLNQSGTSVGTDEESDVTQEEERD
GQYFEPVVPLPDLVEVSSGEENEQVVFSHRAKLYRYDKDVGQWKERGIGDIKILQNYDNK
QVRIVMRRDQVLKLCANHRITPDTTLQNMKGTERVWVWTACDFADGERKVEQLAVRFKLQ
DVADSFKKIFDEAKAAQEKDSLITPHVSRSSTPRESPCGKIAVAVLEETTRERTDVIQGD
DVADATSEVEVSSTSETTTKAVVSPPKFVFGSESVKSIFGSEKSKPFAFNSSATGSLFGF
NFNEPLKSNNSETSSVAQSGSESKAEPDKCELSKNSDIEQSSDSKVKNLFASFPTEESSI
NHTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTTEQKALATKLKLPPTFFCYKNRPDYV
SEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENAADNEKECIIVWEKKPTVEEKAKAD
TLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMV
PSFCKSEEPDSITKSISSPSVSSETVDKPVDLSTRKEIDTNSTSQGESKIVSFGFGSSTG
LSLALTLSNSGDFAFGSKDKNFQWANTGAAVFGTQSVGTQSASKVGEDEDGSDEEVVHNE
DIHFEPIVSLPEVEVKSGEEDEEILFKERAKLYRWDRDVSQWKERGVGDIKILWHTMKNY
YRILMRRDQVFKVCANHVITKTMELKPLNVSNNALVWTASDYADGEAKVEQLAVRFKTKE
VADCFKKTFEECQQNLMKLQKGHVSLAAELSKETNPVVFFDVCADSEPLGRITMELFSNI
VPRTAENFRALCTGEKGFGFKNSIFHRVIPDFICQGGDITKHDGTGGQSIYGDKFEDENF
DVKHTGPGLLSMANQGQNTNNSQFFITLTKAEDLDFKHVVFGFVKDGMDTVKKIESFGSP
KGSVCRRITITECGQI
Download sequence
Identical sequences ENSNLEP00000009128 ENSNLEP00000009128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]