SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009294 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009294
Domain Number 1 Region: 322-502
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.7e-46
Family CRAL/TRIO domain 0.0000371
Further Details:      
 
Domain Number 2 Region: 231-317
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 6.15e-23
Family CRAL/TRIO N-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 522-687
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.22e-20
Family Supernatant protein factor (SPF), C-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009294   Gene: ENSNLEG00000007634   Transcript: ENSNLET00000009739
Sequence length 718
Comment pep:novel supercontig:Nleu1.0:GL397688.1:23445:101232:1 gene:ENSNLEG00000007634 transcript:ENSNLET00000009739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQKYQSPVRVYKYPFELIMAAYERRFPTCPLIPMFVGSDTVNEFKSEDGAIHVIERRCK
LDVDAPRLLKKIAGVDYVYFVQKNSLNSRERTLHIEAYNETFSNRVIINEHCCYTVHPEN
EDWTCFEQSASLDIKSFFGFESTVEKIAMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPR
WTPPSITPSSETSSSSCKKQAVSMAVVIPDAALKEGLSGDALSSPSAPEPVVGTPDDKLD
ADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHILRFLRARDFNIDKAREIMCQ
SLTWRKQHQVDYILETWTPPQVQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGEE
ALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVV
EANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKE
IIPDFLSGECMCEVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKGAPHEILIQ
IVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQL
GRDYSMVESPLICKEGESVQGSHVTRWPGFYILQWKFHSMPACAASSLPRVDDVLASLQV
SSHKCKVMYYTEVIGSEDFRGSMTSLESSHSGFSQLSAATTSSSQSHSSSMISRWRFC
Download sequence
Identical sequences G1R7W5
ENSNLEP00000009294 ENSNLEP00000009294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]