SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009484 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009484
Domain Number 1 Region: 217-432
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.72e-52
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000009484
Domain Number - Region: 772-886
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000985
Family WD40-repeat 0.012
Further Details:      
 
Domain Number - Region: 471-528,623-681
Classification Level Classification E-value
Superfamily PH domain-like 0.0115
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009484   Gene: ENSNLEG00000007786   Transcript: ENSNLET00000009939
Sequence length 897
Comment pep:novel supercontig:Nleu1.0:GL397462.1:453140:525918:1 gene:ENSNLEG00000007786 transcript:ENSNLET00000009939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPAWVSNGDAGDTAFSGARHSSWKRKSSRRIDRFTFPALEEDVIYDDVPCESPDAHQPGA
ERNLLYEDAHRAGAPRQAEDLGWSSSEFESYSEDSGEEAKPEVEPAKHRVSFQPKLSPDL
TRLKERYARTKRDILALRVGGRDMQELKHKYDCKMTQLMKAAKSGTKDGLEKTRMAVMRK
VSFLHRKDVIGDSEEEDMGLLEVSVSDIKPPAPELGPMPEGLSPQQVVRRHILGSIVQSE
GSYVESLKRILQDYRNPLMEMEPKALSARKCQVVFFRVKEILHCHSMFQIALSSRVAEWD
STEKIGDLFVASFSKSMVLDVYSDYVNNFTSAMSIIKKACLTKPAFLEFLKRRQVCSADR
VTLYGLMVKPIQRFPQFILLLQDMLKNTPRGHPDRLSLQLALTELETLAEKLNEQKRLAD
QVAEIQQLTKSVSDRSSLNKVLAVGQRPLLGMSPSTWLRLGIRGRVTLHPLRRVFLLNDM
LVCANINFNLAELVGQLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQ
HSGAKKASASGQAQNKVYLGPPRLFQELQDLQIDLAVMKKITLLISTLHGTYQENLNMTV
AQDWCLALQRLMRVKEEEIHSANKCRLRLLLPGKPDKSGRPISFMVVFITPNPLSKISWV
NRLHLAKIGLREENQPGWLCPDEDKKSKAPFWCPILACCIPAFSSRALSLQLGALVHSPV
NCPLLGFSAVSTSLPQGYLWVKGSERGSLGGSAQCVMTASPTSPRSILLYGSLQPVLCLR
HSPFHLLAGLQDGTLAAYPRTSGYHPRKPWKRHGGSDILLYGSVDTGTQCLASCRSPGLQ
PVLCLRHSPFHLLAGLQDGTLAAYPRTSGWAGMNWEISSPPVCLTVGPGPVRTLLTL
Download sequence
Identical sequences ENSNLEP00000009484 ENSNLEP00000009484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]