SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009506 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009506
Domain Number 1 Region: 358-578
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-51
Family DBL homology domain (DH-domain) 0.00034
Further Details:      
 
Domain Number 2 Region: 577-700
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000384
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009506   Gene: ENSNLEG00000007815   Transcript: ENSNLET00000009961
Sequence length 715
Comment pep:novel supercontig:Nleu1.0:GL397462.1:1724309:1731809:-1 gene:ENSNLEG00000007815 transcript:ENSNLET00000009961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCGPPATLQPHLTGPPGTAHGPVAVCQQESLSFAELPALKPPSPVCLDLFPVAPEELRS
PGSRWSLGTPAPLQGLLWPSSPGGSDTEITGGGMRPSRAGSWPHCPGAQPPALEGPWSPQ
HTQPQRRASHGSEKKSAWRKMRVYQREEVPGCPEAHAVFLEPGQVVQEQALSTEEPRVEL
SGSTRVSLEGPERRRFSASELMTRLHSSLRLGRNAARAPISGSGTGVALEGKASGIEARS
VETSGDLVSRPAPGDSREGHGDWSEPRLDTQEEPPLGSRSTNERRQSRFLLNSVLYQEYS
DVASARELRRQQREEEGPGEEAEGAEEGPGPPRANLSPSSSFRAQRSARGSTFSLWQDIP
DVRGSGVLATLSLRDCKLQEAKFELITSEASYIHSLSVAVGHFLGSDELSECLRAQDKQW
LFSKLPEVKSTSERFLQDLEQRLEADVLRFSVCDVVLDHCPAFRRVYLPYVTNQAYQERT
YQRLLLENPRFPGILARLEESPVCQRLPLTSFLILPFQRITRLKMLVENILKRTAQGSDD
EDVATKGFNALKELVQECNASVQSMKRTEELIHLSKKIHSEGKIFPLISQARWLVRHGEL
VEAPLPAAPPAKLKLSSKAVYLHLFNDCLLLSRRKELGKFAVFVYAKMAELQVRDLSLKL
QRIPGHVFLLQLLHGQHMKHQFLLRARTESEKQRWISALCPSSPQEDKEVISEGE
Download sequence
Identical sequences ENSNLEP00000009506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]