SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009556 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009556
Domain Number 1 Region: 539-750
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-45
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 223-367
Classification Level Classification E-value
Superfamily PH domain-like 8.91e-42
Family Third domain of FERM 0.00024
Further Details:      
 
Domain Number 3 Region: 907-1059
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-33
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 4 Region: 123-225
Classification Level Classification E-value
Superfamily Second domain of FERM 1.24e-27
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 5 Region: 736-758,790-891
Classification Level Classification E-value
Superfamily PH domain-like 4.62e-23
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 
Domain Number 6 Region: 42-122
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.41e-23
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009556   Gene: ENSNLEG00000007845   Transcript: ENSNLET00000010014
Sequence length 1076
Comment pep:novel supercontig:Nleu1.0:GL397455.1:969432:1212829:1 gene:ENSNLEG00000007845 transcript:ENSNLET00000010014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIRIQMLDDTQEAFEVPQRA
PGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFF
PPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEALDREHL
AKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKI
NLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSAYQDTLEFLMASRD
FCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQ
FERKHSKIHSIRSLASQPTELNSEVPEQSQQSASLTFGEGAESPGGQSCQQGKEPKFSPG
EPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHL
SELSVNSQRGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDESRRKRFPTDK
AYFIAKEVSTTERTYLKDLEVITSWFQSTVSKDDAMPEALKSLIFPNFEPLHKFHTNFLK
EIEQRLALWEGRSNAQIRDYQRIGDVMLKNIQGMKHLAAHLWKHSEALEALENGIKSSRR
LENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSHADFRDCRAALAEI
TEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPGRPGSFSLIRTPHLGHARPIPCAP
ERRPLLLVKEFIRLGSLSKLSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYG
MTIEESEDEWGVPYCLTLRGQRQSIIVAASSRSEMEKWVEDIQMAIDLAEKSSSPAPEFL
ASSPPDNKSPDEATAADQESEDDLSASRTSLERQAPHRGNTMVHVCWHRNTSVSMVDFSI
AVENQLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDNHPLASLPLLGYSLTIPSES
ENIHKDYVFKLHFKSHVYYFRAESEYTFERWMEVIRSATSSASRAHVLSHKESLVY
Download sequence
Identical sequences A0A2I3HA07
XP_003279255.1.23891 ENSNLEP00000009556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]