SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009768 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009768
Domain Number 1 Region: 209-410
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-51
Family DBL homology domain (DH-domain) 0.00000000319
Further Details:      
 
Domain Number 2 Region: 402-526
Classification Level Classification E-value
Superfamily PH domain-like 2.44e-36
Family Pleckstrin-homology domain (PH domain) 0.0000127
Further Details:      
 
Domain Number 3 Region: 134-205
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-25
Family SH3-domain 0.0000378
Further Details:      
 
Domain Number 4 Region: 6-94
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00001
Family Calponin-homology domain, CH-domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009768   Gene: ENSNLEG00000007989   Transcript: ENSNLET00000010239
Sequence length 750
Comment pep:novel supercontig:Nleu1.0:GL397328.1:12007913:12149763:1 gene:ENSNLEG00000007989 transcript:ENSNLET00000010239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVLQVYPEPRSESECLSNIREFLRGCGASLRLEVSAGGHRPRLYFCLFNFSFQTFDANDL
YQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQG
QYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGW
FPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQT
VLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLN
LMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDK
YPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGD
DIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMT
ITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVDHLQKQTKVTSVGNPTIKPHSV
PSHTLPSHPVTPSCKHAHSKPAPLTPAYHTLPHPSHHGIPYTSIIWGPLDTPISLTCSLN
CLRPVPTLRASFVLCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQI
LKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDLSED
SDYDSIWTAHSYRMGSTSRKSCCSYISHQN
Download sequence
Identical sequences ENSNLEP00000009768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]