SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009860 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009860
Domain Number 1 Region: 41-92
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000153
Family CUE domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009860   Gene: ENSNLEG00000008075   Transcript: ENSNLET00000010337
Sequence length 386
Comment pep:novel supercontig:Nleu1.0:GL397344.1:7366611:7420860:-1 gene:ENSNLEG00000008075 transcript:ENSNLET00000010337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLFRRSSSGSGGGGTAGARGGGGGTAAPQELNNSRPARQVRRLEFNQAMDDFKTMFPN
MDYDIIECVLRANSGAVDATIDQLLQMNLEGGGGGGGFYEDSSDSEDSIPPEILERTLEP
DSSDEEPPPVYSPPAYHMHVFDRPYPLAPPTPPPRTDALGSGAPTSQRRYRNWNPPLLGN
LLDDFLRILPQQLDSMQGNAGGPKPGSGEGGPPAMAGPGPRDQESRWKQYLEDERIALFL
QNEEFMKELQRNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFPSPVPGTGDANPAVSE
DALFRDKLKHMGKSTRRKLFELARAFSEKTKMRKSKRKHLLKHQSLGAAASTANLLDDVE
GHACDEDFRGRRQEAPKVEEGLREGQ
Download sequence
Identical sequences G1R9G8
XP_003272344.1.23891 ENSNLEP00000009860 ENSNLEP00000009860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]