SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009861 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009861
Domain Number 1 Region: 440-573
Classification Level Classification E-value
Superfamily PH domain-like 1.88e-16
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 2 Region: 580-639
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000521
Family SH3-domain 0.002
Further Details:      
 
Domain Number 3 Region: 338-384
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000000589
Family DBL homology domain (DH-domain) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009861   Gene: ENSNLEG00000008083   Transcript: ENSNLET00000010338
Sequence length 659
Comment pep:novel supercontig:Nleu1.0:GL397433.1:432928:455102:1 gene:ENSNLEG00000008083 transcript:ENSNLET00000010338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAFQPEVPAPPQPRPPGHEEPRPIVLSTESPAALKLGTQQLIPKSLAMASKAKTPARHQS
FGAAVLSREAARRNPKLLPAPSFSLDDMDMDKDPGGMLRRNLRNQSYRAAMKGLGKPGVQ
GDAIQLSPKLQALAEEPSQPHTRSPAKNKKTLGRKRHKGSFKDDPQLYQEIQERGLNTSQ
ESDDDILDESSSPEGARKVDTTIVVKSYRPAQVTWSQLPEVVELGILDQLSTEERKRQEA
LTEPLRITGGIQGRWAGVSKPAILTAPIQGSSEVRPHHSLPHKVLCQEGASSRGHDTVIS
RGEPELPLDVDGLRQLLASMESRLILVQAGHAGPGRTALSSCRSSNAAFREVLREIERRP
ACGGLPMLSFLILPMQRVTRLPLLTDVKRLTSMGWWWQRPGAGGAGGSESVVGTGGEAGA
HREQVGRSPPTDLRLLALSPQSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFL
FNDVLVVTKKKSEESYVVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHPFQVTLLRN
SEGRQEQLLLSSDSASDRARWIVALTHSERQWQGLSNKGDLPQVEITKAFFAKQADEVTL
QQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRMERLRVETDV
Download sequence
Identical sequences ENSNLEP00000009861 ENSNLEP00000009861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]