SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009943 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009943
Domain Number 1 Region: 501-742
Classification Level Classification E-value
Superfamily vWA-like 1.78e-76
Family Trunk domain of Sec23/24 0.00000599
Further Details:      
 
Domain Number 2 Region: 697-835
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.96e-39
Family beta-sandwich domain of Sec23/24 0.00075
Further Details:      
 
Domain Number 3 Region: 944-1092
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 6.02e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.00092
Further Details:      
 
Domain Number 4 Region: 274-467
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.12e-29
Family beta-sandwich domain of Sec23/24 0.0019
Further Details:      
 
Domain Number 5 Region: 839-940
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 8.89e-26
Family Helical domain of Sec23/24 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009943   Gene: ENSNLEG00000008135   Transcript: ENSNLET00000010428
Sequence length 1093
Comment pep:novel supercontig:Nleu1.0:GL397305.1:2048293:2129643:1 gene:ENSNLEG00000008135 transcript:ENSNLET00000010428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPGIPASGGAPASLQAQNGAALASGSPYTNGPVQNALLSSQESASQGYNFQLPGSYPH
PIPAKTLNPVSGQSNYGGSQGSGQTLNRPPVASNPVTPSLHSGPAPRMPFPASQNPSTTP
MPSSSFLPGANLPPPLNWQYNYPSTASQTNHCPRASSQPTVSGNTSLTTNHQYVSSGYPS
LPNSFIKSGSSVPPLANPPLPTTFQPGVPHGPPPAGGPPPIRALMPQTSSYRDVPQPSFN
SAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQ
NTTPPGATGVPPSSLNYPSGPQAFTQTPLGANHLTTSMSGLSLQPEGLRVVNLLQERNML
PTTPLKPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLVQL
PVVTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFLYNPLTRVYGEPHRR
PEVQNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDNLDLLPGNT
RTKIGFITFDSTIHFYSLQEGLSQPQMLIVSDIEDVFIPMPENLLVNLNESKELVQDLLK
TLPQMFTKTLETQSALGPALQAAFKLMSPTGGRMSVFQTQLPTLGVGALKPREEPNHRSS
AKDIHLTPSTDFYKKLALDCSGQQVAVDLFLLSGQYSDLASLGCISRYSAGSVYYYPSYH
HQHNPVQVQKLRKELQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVN
PDAGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNDVFLGADV
QAISGLLANMAVDRSMTASLSDARDALVNAVIDSLSAYRSSVLSNQQPGLMVPFSLRLFP
LFVLALLKQKSFQTGTNARLDERIFAMCQVKNQPLLYLMLTTHPSLYRVDSLSDEGALNI
SDRTIPQPPILQLSVEKLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNYASIPQP
MTDLPELDTPESARIIAFISWLREQRPFFPILYVIRDESPMKANFLQNMIEDRTESALSY
YEFLLHIQQQVNK
Download sequence
Identical sequences G1R9P7
ENSNLEP00000009943 XP_003266439.1.23891 ENSNLEP00000009943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]