SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009948 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009948
Domain Number 1 Region: 391-523,755-934
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.96e-37
Family Diacylglycerol kinase-like 0.061
Further Details:      
 
Domain Number 2 Region: 109-237
Classification Level Classification E-value
Superfamily PH domain-like 5.25e-24
Family Pleckstrin-homology domain (PH domain) 0.0053
Further Details:      
 
Domain Number 3 Region: 294-335
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000262
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00061
Further Details:      
 
Domain Number 4 Region: 222-282
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000297
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009948   Gene: ENSNLEG00000008157   Transcript: ENSNLET00000010433
Sequence length 1172
Comment pep:novel supercontig:Nleu1.0:GL397404.1:1504987:1618020:-1 gene:ENSNLEG00000008157 transcript:ENSNLET00000010433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PWPPPPPPPAPPPAPPLLFQASPEPIPEPCPELAPGPQPALESVPELTPEVAPEPTPEPV
TDLAPEFCPEAAPESRPSPAPCLLQCSVDTRERGLKTSPSPSPSPRTPMSWSRIKKILKE
GPMLKNCNSFKRWKLRYFLVQGQKLYFAHHPAFAHFETIDLSQATVAESSCRNLCHSFCV
ITPQRKITLAAPNRKDMEEWINIIKTVQQGEIYKIPAAENNPFLVGMHCWYSSYSHRTQH
CNICRESIPALSRDAIICEVCKVKSHRLCALRASKDCKWNTLSITDDLLLPADEVSMPHQ
WVEGNMPVSSQCAVCHESCGSYQRLQDFRCLWCNSTSLTTNLRNLYLKTVMSRFHLNGSV
LFFLLFLFVVSGQLVVSSDFWNLDWSSACSCPLLIFINSKSGDHQGIIFLRKFKQYLNPS
QVFDLLKGGPEAGLSMFKNFARFRILVCGGDGSVSWVLSLIDAFGLHERSQVFALPLSTP
KAMGRCKGWEEGLQLNYSPQPVKHFGEVGIHRILAIWSVMIREAPRQTLLQKGQVEMDVP
RFEAAAIQHLESAATELNKILKAKYPTEMIIATRFLCSAVEDFVVDIVKAWGQIKQNNTA
IVSVILKSDLMYDKLSVLIDVLAEEAAATSAEKSATVYADSSKADRKPFVPQIDHIAKCK
LELATKAQNLQKSLKLIIFQVEQVLDEESRQTISVKNFSSTFFLEDDPEDINQTSPQRRS
HRGTLSSISSLKSEDLDNLNLDHLHFTPESICFKEKCVMNNYFGIGLDAKISLDFNTRRD
EHPGQYNSRLKNKMWYGLLGTKELLQRSYRKLEERVHLECDGETISLPNLQGIVVLNITS
YAGGINFWGSNTATTEYEAPAIDDGKLEVVAIFGSVQMAMSRIINLHHHRIAQCHEVMIT
IDGEEGIPVQVDGEAWIQRPGLIKIRYKNAAQMLTRDRDFENSMKMWEYKHTVIQAAPQP
QLNSQDSQEGLSDEEYAQMQHLARLAENLISKLNDLSKIHQHVSVLMDSVNASANILNDI
FYGQDSGNEMGAASCIPIETLSRNDAVDVTFSLKGLYDDTTAFLDEKLLRSAEDETALQS
ALDAMNKEFKKLSEIDWMNPIFVPEEKSSDTDSRSLRLKIKFPKLGKKKLEEERKHKSGQ
SVQSFIGNLWHRRHHEDEAEGDDPLTPSRSQL
Download sequence
Identical sequences ENSNLEP00000009948 ENSNLEP00000009948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]