SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009988 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009988
Domain Number 1 Region: 288-350,383-517
Classification Level Classification E-value
Superfamily RNI-like 3.27e-30
Family 28-residue LRR 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009988   Gene: ENSNLEG00000008204   Transcript: ENSNLET00000010476
Sequence length 517
Comment pep:novel supercontig:Nleu1.0:GL397536.1:15580:20255:1 gene:ENSNLEG00000008204 transcript:ENSNLET00000010476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPGRLQGRLCSPQCAEVRGLSDKDKKKYFYKFFQDERRAERAYRFVKENETLFALCFVPF
VCWIVCTVLRQQLEMGRDLSRTSKTTTSVYMLFIASVLSSAPVADGPRVQGDLRNLCRLA
REGVLGRRAQFAEKELEQLELRGSKVQTLFLSKKELPGVLETEVTYQFIDQSFQEFLAAL
SYLLEDGGVPWTAAGGVGTLLPGDAQPHSHLVLTTRFLFGLLSAERTRDIERHFGCMVSE
RVKQEALRWVQGQGRGCPGVAPEVTEGAKGLEDTEEPEEEEEGEEPNYPLELLYCLYETQ
EDAFVRQALCRLPELALQRVRFCRMDVAVLSYCVRCCPAGQALRLISCRLVAAQEKKKKS
LGKRLQASLGGSSSSRGTKKQLPASLLHPLFQAMTDPLCHLSSLTLSHCKVPDAVCRDLS
EALRAAPALTELGLLHNRLSEAGLRMLSEGLAWPQCRVQTVRVQLPDPQRGLQYLVGMLR
QSPALTTLDLSGCQLSAPMVTYLCALLQHQGCGLQTL
Download sequence
Identical sequences ENSNLEP00000009988 ENSNLEP00000009988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]