SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010033 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010033
Domain Number 1 Region: 4-257
Classification Level Classification E-value
Superfamily RNI-like 2.55e-45
Family Cyclin A/CDK2-associated p19, Skp2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010033   Gene: ENSNLEG00000008250   Transcript: ENSNLET00000010526
Sequence length 272
Comment pep:novel supercontig:Nleu1.0:GL397322.1:686537:688166:-1 gene:ENSNLEG00000008250 transcript:ENSNLET00000010526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARLQVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLL
PNLAELSLQAYHVTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSLPNLTALSL
SGCSKVTDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITD
TGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLALGSLRLLSLAGCPLLTTTGLSGLVQLQ
ELEELELTNCPGATPELFKYFSQHLPRCLVIE
Download sequence
Identical sequences ENSNLEP00000010033 ENSNLEP00000010033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]