SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010042 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010042
Domain Number 1 Region: 26-115
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000477
Family FHA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010042   Gene: ENSNLEG00000008259   Transcript: ENSNLET00000010537
Sequence length 204
Comment pep:novel supercontig:Nleu1.0:GL397305.1:2860450:2864059:-1 gene:ENSNLEG00000008259 transcript:ENSNLET00000010537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKPLTILRVSLYHPTLGPSAFANVPPQLQHDTSPLLLGRGQDTHLQLQLPRLSRHHLSL
EPYLEKGSALLAFCLKALSRKGCVCVNGLTLRYLEQVPLSTVNRVSFSGIQMLVRLEEGT
SLEAFVCYFHISPSPLIYRPEAEETDEWEGISQEQPPPGSGQQTPGCLGFLHGPSQTWDS
PLQPRPGGGTEIQLQREPPDSALC
Download sequence
Identical sequences XP_003266453.1.23891 ENSNLEP00000010042 ENSNLEP00000010042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]