SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010095 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010095
Domain Number 1 Region: 42-122
Classification Level Classification E-value
Superfamily F-box domain 8.76e-19
Family F-box domain 0.0028
Further Details:      
 
Domain Number 2 Region: 157-387
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000345
Family 28-residue LRR 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010095   Gene: ENSNLEG00000008304   Transcript: ENSNLET00000010594
Sequence length 434
Comment pep:novel supercontig:Nleu1.0:GL397305.1:3317805:3329162:1 gene:ENSNLEG00000008304 transcript:ENSNLET00000010594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRNSLSVENKIVQLSGAVKQPKVGFYSSLNQTHTHTVLLDWGSLPHHVVLRIFQYLPLL
DRAHASSVCRRWNEVFHIPDLWRKFEFELNQSATSYFKSTHPDLIQQIIKKHSAHLQYVS
FKVDSSAESAEAACDILSQLVNCSIQTLSLISTAKPSFMNVSESHFVSALTVVFINSKLL
SSIKIEDTPVDDPSLKILVANNSDTLRLLKMSSCPHVSSDGILCVADHCRGLRELALNYY
ILTDELLLALSSETHVNLEHLRIDVVSENPGQIKFHPIKKHSWDALIKHSPRVNVVMYFF
LYEEEVETFFKEETPVTHLYFGRSVSKAVLGQVGLNCPRLIELVVCANGLQPLDNELICI
AEHCTNLTALGLSECEVSCSAFIKFVRLCGRRLTQLSIMEEVLIPDEDYSLDEIHTEVSK
YLGRVWFPDVMPLW
Download sequence
Identical sequences G1RA48
XP_003266459.1.23891 ENSNLEP00000010095 ENSNLEP00000010095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]