SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010186 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010186
Domain Number 1 Region: 276-404,716-889
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.29e-51
Family Diacylglycerol kinase-like 0.022
Further Details:      
 
Domain Number 2 Region: 6-131
Classification Level Classification E-value
Superfamily PH domain-like 9.11e-29
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 
Domain Number 3 Region: 1095-1160
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.57e-19
Family SAM (sterile alpha motif) domain 0.0047
Further Details:      
 
Domain Number 4 Region: 177-246
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.24e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000187
Further Details:      
 
Domain Number 5 Region: 113-172
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000449
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010186   Gene: ENSNLEG00000008355   Transcript: ENSNLET00000010686
Sequence length 1168
Comment pep:novel supercontig:Nleu1.0:GL397439.1:252474:336939:1 gene:ENSNLEG00000008355 transcript:ENSNLET00000010686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMFLYFQTIIKEGMLTKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVA
ESSTKNVNNSFTVITPCRKLILCADNRKEMEDWIAALKTVQNREHFEPTQYSMDHFSGMH
NWYACSHARPTYCNVCREALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKD
IIEDADGIAMPHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLLT
KCPLGLCKVSVIPPTALNSIDSDGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQ
LLNPAQVFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVL
PLGTGNDLARVLGWGSACDDDTQLPQILEKLERASTKMLDRWSVMAYEAKLPRQASSSTV
TEDFSEDSEVQQILFYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEK
TTESSEESEVMAKKCSVLKEKLDSLLKTLDDESQASSSLPNPPPTIAEEAEDGDGSGSVC
SSMGDRLVASACPARPQIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEQEGF
VLGLSESEEKMDHRVCPPLSHSESFGVPKGRSQRKVSKSPCEKLISKGSLSLGSSASLPP
QTGSRDGLPALNTKILYPNVRAGMSGSLPGGSVISRLLINADPFNSEPETLEYYTEKCVM
NNYFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLE
CDGRPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMA
VSRVIRLQHHRIAQCRTVNISILGDEGVPVQVDGEAWVQPPGYIRIVHKNRAQTLTRDRA
FESTLKSWEDKQKCELPRPPSCSLHPEMLSEEEATQMDQFGQAAGVLIHVGSCPSALRMS
LPRGPRDCALPRPLGRGAAAPDLGVGLNCSFVLEMVNNFRALRSETELLLSGKMALQLDP
PQKEQLGNALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKE
KNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDLKD
LGVTKVGHMKRILCGIKELSRSAPAAEA
Download sequence
Identical sequences ENSNLEP00000010186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]