SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010758 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010758
Domain Number 1 Region: 359-427,662-997
Classification Level Classification E-value
Superfamily Ras GEF 8.37e-121
Family Ras GEF 0.0000104
Further Details:      
 
Domain Number 2 Region: 6-172
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-33
Family DBL homology domain (DH-domain) 0.00051
Further Details:      
 
Domain Number 3 Region: 209-314
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000135
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010758   Gene: ENSNLEG00000008805   Transcript: ENSNLET00000011278
Sequence length 1000
Comment pep:novel supercontig:Nleu1.0:GL397378.1:3148227:3277421:-1 gene:ENSNLEG00000008805 transcript:ENSNLET00000011278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLN
IYQEFVRNHQYSLQILAHCKQNRDFDKLLKHYEAKPDCEERTLETFLTYPMFQIPRYILT
LHELLAHTPHEHVERNSLDYAKSKLEELSRIMQDEVSEKENIWKKMAIERMIIEGCEILR
DTSQTFVSQGSLIQVPMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLH
LTKNGVISLIDCTLLEEPESTEEEAKGSGQDIDHLDFKIGVEPKDSPPFTVILVASSRQE
KAAWTSDISQCVDNIRCNGLMMNAFEENSKVTVPQMIKRTREGTREAEMSRSDASLYCDD
VDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTTAIVVLDKL
ITIYKKPISAIPARWLRSLELLFASGQNNKLLYGEPPKSPRATRKFSSPPPLSITKTSSP
SRRRKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKATLDTSKLYVSSSFTNK
IPDEGDTTPEKPEDPSALSKQSSEVSVREESDTDQNQSDDGDTETSPTKSPTTPKSVKSK
NSSDLALQLNQVTLPTSNKTALSPPSTSSAQTPFIILTTLQKGQTPDPEGSLRSSLDTSW
FPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELKCKVIGFLEEMHDPELL
TQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLDHLV
FKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSTIEKW
VAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFK
NLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQ
TAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKLPT
Download sequence
Identical sequences ENSNLEP00000010758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]