SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011086 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011086
Domain Number 1 Region: 281-408
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 410-514
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-24
Family Third domain of FERM 0.0057
Further Details:      
 
Domain Number 3 Region: 34-145
Classification Level Classification E-value
Superfamily PDZ domain-like 2.73e-16
Family PDZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 192-275
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000434
Family Ras-binding domain, RBD 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011086   Gene: ENSNLEG00000009084   Transcript: ENSNLET00000011632
Sequence length 1311
Comment pep:novel supercontig:Nleu1.0:GL397281.1:9809510:10044112:1 gene:ENSNLEG00000009084 transcript:ENSNLET00000011632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSSHRTKSSGWPPPSGTWGLSQVPPYGWEMTANRDGRDYFINHMTQAIPFDDPRLESCQI
IPPAPRKVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLIPGDQIVMINDEPVSAA
PRERVIDLVRSCKESILLTVIQPYPSPKSAFISAAKKARLKSNPVKVRFSEEVIINGQVS
ETVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIKGIEHFSLMLEQ
RTEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPKDPIDLLRRDPVAFEYLYVQ
SCNDVVQERFGPELKYDIALRLAALQMYIATVTTKQTQKISLKYIEKEWGLETFLPSAVL
QSMKEKNIKKALSHLVKANQNLVPPGKKLSALQAKVHYLKFLSDLRLYGGRVFKATLVQA
EKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFSEEESLVRVELHVLDVKP
ITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNTATQETGTENKGKHNLLGPDW
NCIPQMTTFIGEGEQEAQITYIDSKQKTVEITDNTMCPKEHRHLYIDNAYSSDGLNQQLS
QPGEAPCEADYRSLAQRSLLTLSGPETLKKAQESPRGAKVSFIFGDFALDDGISPPTLGY
ETLLDESPEMLEKQRNLYIGSASDMKGLDLTPEAEGIQFVENSVYANIGDVKSFQAAEGI
EEPLLHDICYAENTDDAEDEDEVSCEEDLVVGEMNQPAILNLSGSSDDIIDLTSLPPPEG
DDNEDDFLLRSLNMAIAAPPPGFRDSSDEEDSQSQAASFPDDKEKGSSLQNDEIPVSLID
AVPTSAEGKCEKGLDNAVVSTLGALEALSVSEEQQTSDNSGVAILRAYSPESSSDSGNET
NSSEMTESSELATAQKQSENLSRMFLATHEGYHPLAEEQTEFPASKTPAGGLPPKSSHAL
AARPATDLPPKVVPSKQLLHSDHMEMEPETMETKSVTDYFSKLHMGSVAYSCTSKRKSKL
ADGEGKAPPNGNTTGKKQQGTKTAEMEEDASGKFGTVSSRDSQHLSTFNLERTAFRKDSQ
RWYVAPEGGMAEKSGLEAATGKTFPRASGLGAREAEGKEEGAPDGETSDGSGLGQGDRFL
TDVTCASSAKDLDNPEDADSSTCDHPSKLPEADESVARLCDYHLAKRMSSLQSEGHFSLQ
SSQGSSVDAGCGTGSSGSACATPVESPLCPSLGKHLIPDASGKGVNYIPSEERAPGLPNH
GATFKELHPQTEGMCPRMTVPALHTAINTEPLFGTLRDGCHRLPKIKETTV
Download sequence
Identical sequences ENSNLEP00000011086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]