SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011109 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011109
Domain Number 1 Region: 483-780
Classification Level Classification E-value
Superfamily L domain-like 1.16e-44
Family Ngr ectodomain-like 0.0028
Further Details:      
 
Domain Number 2 Region: 869-1021
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.75e-36
Family Toll/Interleukin receptor TIR domain 0.0000976
Further Details:      
 
Domain Number 3 Region: 35-257
Classification Level Classification E-value
Superfamily L domain-like 5.24e-34
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 4 Region: 195-434
Classification Level Classification E-value
Superfamily RNI-like 1.65e-30
Family Rna1p (RanGAP1), N-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011109   Gene: ENSNLEG00000009126   Transcript: ENSNLET00000011658
Sequence length 1040
Comment pep:novel supercontig:Nleu1.0:GL397281.1:10214997:10231854:1 gene:ENSNLEG00000009126 transcript:ENSNLET00000011658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENMFLQSSMLTCLFLLISGSCELCAEENFYRSYPCDEKNQNDSVIAECSNRRLQEVPQTV
GKYVTELDLSNNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGAF
LNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNC
YFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLYLSNTQIKYIGEED
FKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLRK
INAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPHLEILDLSFNYIKGSYPQHINISK
NFSKLLSLRALHLRGYVFQELREQDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNLE
IIYLSENRISPLVKDTRQSYANSSSFQRHILKRRSTDFEFDPHSNFYHFTRPLIKPQCAA
YGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNNR
LDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLTD
KYKLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLTNLTRLDLSLNRLKHIPNEAFLN
LPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLFFLTDSLSDFTSSLRTLLLSH
NRISHLPSGFLSEVSSLVHLDLSSNLLKTINKSALETKTTTKLFKLELHGNPFECTCDIG
DFRRWMDEHLNFRIPRLVDVICASPGDQRGKSIVSLELTTCVSDVTAVILFFFTFFITTM
VMLAALAHHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVINEL
RYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTKKYAKSWNFKTAFY
LALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRNV
VLTENDSRYNNMYVDSIKQY
Download sequence
Identical sequences ENSNLEP00000011109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]