SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011448 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011448
Domain Number 1 Region: 2179-2477
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.1e-96
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000438
Further Details:      
 
Domain Number 2 Region: 665-773
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-33
Family Second domain of FERM 0.0002
Further Details:      
 
Domain Number 3 Region: 1074-1182
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-27
Family PDZ domain 0.0068
Further Details:      
 
Domain Number 4 Region: 775-881
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-26
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 5 Region: 1350-1463
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-25
Family PDZ domain 0.0000136
Further Details:      
 
Domain Number 6 Region: 1787-1876
Classification Level Classification E-value
Superfamily PDZ domain-like 8.41e-22
Family PDZ domain 0.015
Further Details:      
 
Domain Number 7 Region: 1496-1599
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-20
Family PDZ domain 0.028
Further Details:      
 
Domain Number 8 Region: 571-664
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-16
Family First domain of FERM 0.02
Further Details:      
 
Domain Number 9 Region: 1879-1969
Classification Level Classification E-value
Superfamily PDZ domain-like 3.19e-16
Family PDZ domain 0.029
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000011448
Domain Number - Region: 2-152
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00065
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011448   Gene: ENSNLEG00000009323   Transcript: ENSNLET00000012009
Sequence length 2492
Comment pep:novel supercontig:Nleu1.0:GL397302.1:18652516:18872369:1 gene:ENSNLEG00000009323 transcript:ENSNLET00000012009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLP
SGSVSFTDENISNQDLRAFTAPEVLQNQSLTSLSDVEKIHVYSLGMTLYWGADYEVPQSQ
PIKLGDHLNSMLLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGTDQLSCNSEQKPDRSQAIRDRLRGKGLPTGRSSTSDVLDIQKPPLSHQTFLNKGLSKS
MGFLSIRDTQDEDYFKDILSDNSGHEDSENTCSPYQFKTSGPEKKPIPGIDVLSKKKIWA
SSMDLLCTADRDFSSGETATYPHCHPKAVTVRTSTTPRKKEARYSDGSIAFDIFGPQKMD
PIYHTRELPTSSAISSALDRIRERQKKLQVLREAMNVEEPVRRYKTYHGDVFSTSSESPS
IISSESDFRQVRRSEASKRFESSSGLPGVDETLSQGQSQRPSRQYETPFEGNLINQEIML
KRQEEELMQLQAKMALRQSRLSLYPGDTIKASMLDITRDPLREIALETAMTQRKLRNFFG
PEFVKMTIEPFISLDLPRSILTKKGKNEDNRRKVNIMLLNGQRLELTCDTKSICKDVFDM
VVAHTGLVEHHLFALATLKDNEYFFVDPDLKLTKVAPEGWKEEPKKKTKATVNFTLFFRI
KFFMDDVSLIQHTLTCHQYYLQLRKDILEERMHCDDETSLLLASLALQAEYGDYQPEVHG
VSYFRMEHYLPARVMEKLDLSYIKEELPKLHNTYVGASEKETELEFLKVCQRLTEYGVHF
HRVHPEKKSQTGILLGVCSKGVLVFEVHNGVRTLVLRFPWRETKKISFSKKKITLQNTSD
GIKHAFQTDNSKVCQYLLHLCSYQHKFQLQMRARQSNQDAQDIERASFRSLNLQAESVRG
FNMGRAISTGSLASSTLNKLAVRPLSVQAEILKRLSCSELSLYQPLQNSSKEKNDKASWE
EKPREMSKSYHDLSQASLYPHRKNVIVNMEPPPQTVAELVGKPSHQMSRSDAESLAGVTK
LNNSKSVASLNRSPERRKHESDSSSIEDPGQAYVLGVTMHSSGNSSSQVPLKENDVLHKR
WSIVSSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLDLGIFISSIAPGGPADLDGCLKP
GDRLISVNSVSLEGVSHHAAIEILQNAPEDVTLVISQPKEKISKVPSTPVHLTNEMKNYM
KKSSYMQDSAIDSSTKDHHWSRGTLRHISENFGLSGGLREGSVSSQDSRTESASLSQSQV
NGFFASHLGDQTWQESQHGSPSPSVISKATEKKTSTDSNQSKTKKPGISDATDYSDHGDS
DMDEATYSSSQDHQTPKQESSSSVNTSNKMNFKTFSSSPPKPGDIFEVELAKNDNSLGIS
VTVLFDKGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVE
TLRNTGQVVHLLLEKGQSPTSKEHVPVTPQCTLSDQNVQGQGPEKVKKTTQVKDYSFVTE
ENTFEVKLFKNSSGLGFSFSREDNLIPEQINASIVRVKKLFPGQPAAESGKIDVGDVILK
VNGASLKGLSQQEVISALRGTAPEVFLLLCRPPPGVLPEIDTALLTPLQSPAQVLPNSSK
DSSQPSCVEQSTSSDENEMSDKSKKQCKSPSRRDSYSDSSGSGEDDLVTAPANISNSTWS
SALHQTLSNMVSQAQSHHEAPKSQEDTICTMFYYPQKIPNKPEFEDSNPSPLPPDMAPGQ
SYQPQLESASSSSMDKYHIHHISEPTRQENWTPLKNDLENHLEDFELEVELLITLIKSEK
GSLGFTVTKGNQRIGCYVHDVIQDPAKSDGRLKPGDRLIKVNDTDVTNMTHTDAVNLLRA
ASKTVRLVIGRVLELPRIPVLPHLLPDITLTCNKEELGFSLSGGHDSLYQVVYISDINPR
SVAAIEGNLQLLDVIHYVNGVSTQRMTLEEVNRALDMSLPSLVLKATRNDLPVVPSSKRS
AVEAPKSTKGNGSYSVRSCSQPALTPNDSFSTVDGEEINEISYPKGKCSTYQIKGSPNLT
LSKESYIQEDDIYDDSQEAEVIQSLLDVVDEEAQNLLNENNAAGNSCVPGTLKMNGKLSE
ERTEDTDCGCSPLPEYFTEATKMNGCEEYCEYCEEKVKSESLIQKSQEKKTDGDEITWGS
DELPIERTNHEDSDKDHSFLTNDELAVLPVVKVLPSGKYTGANLKSVIRVLRGLLDQGIP
SKELENLQELKPLDQCLIGQTKENRKKNRYKNILPYDATRVPLGDEGGYINASFIKIPVG
KEEFVYIACQGPLPTTVGDFWQMSWEQKSTVIAMMTQEVEGEKIKCQRYWPNILGKTTMV
SNRLRLTLVRMQQLKGFVVRAMTLEDIQTREVRRISHLNFTAWPDHDTPSQPDDLLTFIS
YMRHIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQT
EDQYIFCYQVILYVLTRLQAEEEQKQQPQLLK
Download sequence
Identical sequences A0A2I3GNY2
XP_012355044.1.23891 ENSNLEP00000011448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]