SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011453 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011453
Domain Number 1 Region: 5-364
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.19e-132
Family Motor proteins 0.0000000000199
Further Details:      
 
Domain Number 2 Region: 531-636
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.33e-28
Family FHA domain 0.00000774
Further Details:      
 
Domain Number 3 Region: 1580-1636,1674-1771
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-26
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011453   Gene: ENSNLEG00000009397   Transcript: ENSNLET00000012015
Sequence length 1792
Comment pep:novel supercontig:Nleu1.0:GL397361.1:3691233:3868427:1 gene:ENSNLEG00000009397 transcript:ENSNLET00000012015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHT
SPEDPCFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIP
QLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVED
LSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDNETNLSTEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKK
TDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVI
NEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDIDPLIDDYSGSGSKYLKDFQNNKHRYL
LASENQRPGHFSTASMGSLTSSPSSCSLSSQVGLTSVTSIQERIMSTPGGEEAIERLKES
EKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNED
PLMSECLLYYIKDGITRVGQADAERRQDIVLSGAHIKEEHCIFRSERNNSGEVIVTLEPC
ERSETYVNGKRVSQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWT
FAQRELLEKQGIDMKQEMEKRLQEMEILYKKEKEEADLLLEQQRLDYESKLQALQKQVET
RSLAAETTEEEEEEEEVPWTQHEFELAQWAFRKWKSHQFTSLRDLLWGNAVYLKEANAIS
VELKKKVQFQFVLLTDTLYSPLPPELLPTEMEKTHEDRPFPRTVVAVEVQDLKNGATHYW
SLEKLKQRLDLMREMYDRAGEMASSAQDESETTVTGSDPFYDRFHWFKLVGSSPIFHGCV
NERLADRTPSPTFSTADSDITELADEQQDEMEDFDDEAFVDDAGSDAGTEEGSDLFSDGH
DPFYDRPLVHFSGKVGEVIVIKSCFFFSALADEEAPDYGSGIRQSGTAKISFDNEYFNQS
DFSSVAMTRSGLSLEELRIVEGQGQSSEVITPPEEINRMNDLDLKSSTLLDGKMVMEGFS
EEIGNHLKLGSAFTFRVTVLQASGILPEYADIFCQFNFLHRHDEAFSTEPLKNNGRGSPL
AFYHVQNIAVEVTESFVDYIKTKPIVFEVFGHYQQHPLHLQGQELNSPPQPCRRFFPPPM
PLSKPVPATKLNTMSKTSLGQSMSKYDLLVWFEISELEPTGEYIPAVVDHTAGLPCQGTF
LLHQGIQRRITVTIIHEKGSELHWKDVRELVVGRIRNKPEVDEAAVDAILSLNIISAKYL
KSSHNSSRTFYRFEAVWDSSLHNSLLLNRVTPYGEKIYMTLSAYLELDHCIQPAVITKDV
CMVFYSRDAKISPPRSLRSLFGSGYSKSPDSNRVTGIYELSLCKMSDTGSPGMQRRRRKI
LDTSVAYVRGEENLAGWRPRGDSLILEHQWELEKLELLHEVEKTRHFLLLRDRLGDSIPK
SLSDSLSPSLSSGTLSTSTSISSQISTTTFESAITPSESSGYDSADIESLVDREKELATK
CLQLLTHTFNREFSQVHGSISDCKLSDISPIGRDPSESSFSSATLTPSSTCPSLVDSRSN
SLDQKTPEANSRASSPCPEFEQFQIVPAVETPYLARAGKNEFLNLVPDIEEIRPGSVVSK
KGYLHFKEPLYSNWAKHFVVVRRPYVFIYNSDKDPVERGIINLSTAQVEYSEDQQAMVKT
PNTFAVCTKHRGVLLQALNDKDMNDWLYAFNPLLAGTIQSKLSRRCPSQPKY
Download sequence
Identical sequences ENSNLEP00000011453 ENSNLEP00000011453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]