SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011485 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011485
Domain Number 1 Region: 210-374,447-664
Classification Level Classification E-value
Superfamily RNI-like 1.19e-48
Family 28-residue LRR 0.027
Further Details:      
 
Domain Number 2 Region: 153-236
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000131
Family F-box domain 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000011485
Domain Number - Region: 402-461
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 0.00706
Family Outer arm dynein light chain 1 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011485   Gene: ENSNLEG00000009409   Transcript: ENSNLET00000012049
Sequence length 735
Comment pep:novel supercontig:Nleu1.0:GL397314.1:6631980:6913475:1 gene:ENSNLEG00000009409 transcript:ENSNLET00000012049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPELMIKACSFYTGHLVKTHFCTWRDIARTNENVVLAEKMNRAMTCYNFRLQKSVFHHW
HSYMEDQKEKLKNMLLRIQQIIYCHKLTIILTKWRKTARHKSKKKEDELILKHELQLKKW
KNRLILKRAAAEESNFPEQSSSEVSLVDETLKCDISLLPERAILQIFFYLSLKDVIICGQ
VNHAWMLMTQLNSLWNDIDFSTVKNVIPDKYIVSTLQRWRLNVLRLNFRACLLRPKTFRS
VSHCRNLQELNVSDCPTFTDESMRHISEGCLGVLYLNLSNTTITNRTMRLLPRHFHNLQN
LSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFRYIANSCTGIMHLTINDM
PTLTDNCVKALVEKCSRITSLVFTGAPHISDCTFKALSTCKLRKIRFEGNRRVTDASFKF
IDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNLANCVRIGDMGLKQFLDGPASIR
IRELNLSNCVQLSDASVMKLSERCPNLNYLSLRNCEHLTAQGIGYIVNIFSLVSIDLSGT
DISNEGLNVLSRHKKLKELSVSECYRITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKA
LAIYCINLTSLSIAGCPKITDSAMETLSAKCHYLHILDISGCVLLTDQILEDLQIGCKQL
RILKMQYCTNISKKAAQRMSSKVQQQEYNSNDPPRWFGYDREGNPVTGLDNITSSKGALE
LTVEKSTYNSEDQAV
Download sequence
Identical sequences A0A2I3G5M2
XP_003268227.1.23891 ENSNLEP00000011485 ENSNLEP00000011485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]