SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011723 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000011723
Domain Number - Region: 30-68
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.017
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 
Domain Number - Region: 205-257
Classification Level Classification E-value
Superfamily DNA-binding domain of Mlu1-box binding protein MBP1 0.0222
Family DNA-binding domain of Mlu1-box binding protein MBP1 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011723   Gene: ENSNLEG00000009631   Transcript: ENSNLET00000012300
Sequence length 330
Comment pep:novel supercontig:Nleu1.0:GL397278.1:9826913:10010675:1 gene:ENSNLEG00000009631 transcript:ENSNLET00000012300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHGLAVCLALTTMCTSLLLVYSSLGGQKERPPQQQQQQQQQQASATGSSQPAAESSTQP
RPGVPAGPRPLDGYLGVADHKPLKMHCRDCALVTSSGHLLHSRQGSQIDQTECVIRMNDA
PSRGYGHDVGNRTSLRVIAHSSIQRILRNRHDLLNVSQGTVFIFWGPSSYMRRDGKGQVY
NNLHLLSQVLPRLKAFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCD
RINVYGMVPPDFCRDPNHPSVPYHYYEPFGPDECTMYLSHERGRKGSHHRFITEKRVFKN
WARTFNIHFFQPDWKPESLAINHPENKPVF
Download sequence
Identical sequences ENSNLEP00000011723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]