SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011959 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011959
Domain Number 1 Region: 128-388
Classification Level Classification E-value
Superfamily vWA-like 1.8e-71
Family Trunk domain of Sec23/24 0.0000021
Further Details:      
 
Domain Number 2 Region: 8-66,405-513
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 3.4e-64
Family beta-sandwich domain of Sec23/24 0.00038
Further Details:      
 
Domain Number 3 Region: 617-757
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 5.23e-56
Family C-terminal, gelsolin-like domain of Sec23/24 0.0000063
Further Details:      
 
Domain Number 4 Region: 514-616
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 6.8e-46
Family Helical domain of Sec23/24 0.00000791
Further Details:      
 
Domain Number 5 Region: 49-123
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 3.14e-21
Family Zn-finger domain of Sec23/24 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011959   Gene: ENSNLEG00000009798   Transcript: ENSNLET00000012542
Sequence length 761
Comment pep:novel supercontig:Nleu1.0:GL397314.1:12352354:12403195:1 gene:ENSNLEG00000009798 transcript:ENSNLET00000012542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVL
CSRPTCKAVLNPLCQVDYRAKLWACNFCFQRNQFPPAYGGISEVNQPAELMPQFSTIEYV
IQRGAQSPLIFLYVIDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSYVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPASLSFT
LREPLNILKMPKVFTEKLRIRAIGSTHSELIKGTFPNTGARIMLFTGGPPTQGPGMVVGD
ELKIPIRSWHDIEKDNARFMKKATKHYEMLANRTAANGHCIDIYACALDQTGLLEMKCCA
NLTGGYLVMGDSFNTSLFKQTFQRIFTKDFNGDFRMAFGATLDVKTSRELKIAGAIGPCV
SLNVKGPCVSENELGVGGTSQWKICGLDPTSTLGIYFEVVNQHNAPIPQGGRGAIQFVTH
YQHSSTQRRIRVTTIARNWADVQSQLRHIEAAFDQEAAAVLMARLGVFRAESEEGPDVLR
WLDRQLIRLCQKFGQYNKEDPTSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPDESSYYR
HHFARQDLTQSLIMIQPILYSYSFHGPPEPVLLDSSSILADRILLMDTFFQIVIYLGETI
AQWRKAGYQDMPEYENFKHLLQAPLDDAQEILQARFPMPRYINTEHGGSQARFLLSKVNP
SQTHNNLYAWGQETGAPILTDDVSLQVFMDHLKKLAVSSAC
Download sequence
Identical sequences ENSNLEP00000011959 ENSNLEP00000011959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]