SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012019 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012019
Domain Number 1 Region: 116-409
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000181
Family 28-residue LRR 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012019   Gene: ENSNLEG00000009866   Transcript: ENSNLET00000012604
Sequence length 474
Comment pep:novel supercontig:Nleu1.0:GL397361.1:6425750:6483731:1 gene:ENSNLEG00000009866 transcript:ENSNLET00000012604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQSPSRLLQLAGQSLLRNQLLTIFTLDQLPREVFPLMLMEAFRMRRFEALKLMVQAWP
FVCLPLGSLMKTPHLETLQAVLRGLDTLVSQKVRPRRWKLQVLDLRDVDESFWAIWSGVK
VLSCSPEAMSKRQTVEDCPRMGEHQPLKVFIDLCLKESTLDECLSYLCRWIHYRRGLVHL
CCSKVQNYSMPSSSFRNLLKRVHPDSIQELEVRRKFSLNKTGKFAPYLSQMSNLRKLFLA
FGYGCEIYVSSQQQFAPDLDSPFLCLYYPQMLYIRKISNIKEHLEHLLRCLRNSFVTFTF
CNAYLADEDMECLSQYPSLGQLKELRLTYILMWTTNLEPLGVLLEKVAATLKTLVLEDCR
IQDPQLRVLLPALSRCSQLTTFYFRGNETSTNALKDLLRHTGRLSKLGLELYPAPLESLD
NRGRVNWEILAPIRAELMRTLREVRQPKRIFFGPTPCPSCGSGPSENVDFHLCS
Download sequence
Identical sequences G1RFL9
ENSNLEP00000012019 ENSNLEP00000012019 XP_004092240.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]