SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012034 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012034
Domain Number 1 Region: 182-411
Classification Level Classification E-value
Superfamily RNI-like 1.39e-19
Family 28-residue LRR 0.05
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012034
Domain Number - Region: 78-170
Classification Level Classification E-value
Superfamily RUN domain-like 0.0157
Family RUN domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012034   Gene: ENSNLEG00000009881   Transcript: ENSNLET00000012619
Sequence length 476
Comment pep:novel supercontig:Nleu1.0:GL397361.1:6490153:6500195:1 gene:ENSNLEG00000009881 transcript:ENSNLET00000012619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIRTPPRLLELVGRSLLRDQALAISTLEELPTELFPPLFMEAFNRRRYEALKLMVQAWP
FRRLPLGSLMKRPCPETFQAVLDGLDALLTQGVRLRRWKLQVLDLQDVSENFWMVWSEAM
VHACLPNAMMNRKPVQDCPRMRGQQPLTVFIDLCLKNRTLDEYLTCLLLWVKQREGLVHL
CCKKLKMLGTPFHNVRNILKTVNLDCIQEAEVNCNWTLPVLAEFTPYLGQMKNLQKLVLS
DIDVSLYISPEKKKEFVTQFTSQFLKLRYLQKLSMNSVSFLKGHLDQLLSCLKTPLKILA
ITNCVLLESDLKHLSKCPSISQLKTLDLSGTRLANFSLVPLQVLLERVAATLEDLDLEDC
GIADSQVDTILPALSRCFELTTFGFRGNPISMATLENLLCHTVRLKNLCLELYPAPRESY
DAGGIVCRSRFAQLGAELMKRVRALRKPERILFCTTDCPQCGNRSFYGLEVDQCCC
Download sequence
Identical sequences ENSNLEP00000012034 ENSNLEP00000012034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]