SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012054 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012054
Domain Number 1 Region: 395-538
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 291-396
Classification Level Classification E-value
Superfamily Second domain of FERM 9.68e-36
Family Second domain of FERM 0.000000825
Further Details:      
 
Domain Number 3 Region: 210-290
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-26
Family First domain of FERM 0.00000798
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012054   Gene: ENSNLEG00000009867   Transcript: ENSNLET00000012642
Sequence length 864
Comment pep:novel supercontig:Nleu1.0:GL397339.1:9732926:9860874:1 gene:ENSNLEG00000009867 transcript:ENSNLET00000012642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMTEKSLVTEAENSQHQQKEEGEEAVNSGQQEPQQEESCQTVAEGDNQCEQKLKASNGDT
PTHEDLTKNKERTSESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGERGQKEIEFGT
SLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFETKEGEGLEECS
KIEVKEESPESKAERELKASQKPIRKHRNMHCKVSLLDDTVYECVVEKHAKGQDLLKRVC
EHLNLLEEDYFGLAIWDSATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDI
TRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQT
KELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGL
LVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKVC
VEHHTFFRLTSTDTIPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRAS
RSLDGAAAVNSADRSPRPTSAPAIAQGQVAEGGVLDASAKKTVVPKAQKETVKAEVKKED
EPPEQAEPEPTEAWKVEKTHIEVTVPTSNGDQTQKLAEKTEDLIRMRKKKRERLDGENIY
IRHSNLMLEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNIN
GQIPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKTITYEAAQTDDNSGDLD
PGVLLTAQTITSETTSSTTTTQITKTVKGGISETRIEKKIVITGDADIDHDQVLVQAIKE
AKEQHPDMSVTKVVVHQETEIADE
Download sequence
Identical sequences ENSNLEP00000012054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]