SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012060 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000012060
Domain Number - Region: 162-226
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0969
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012060   Gene: ENSNLEG00000009908   Transcript: ENSNLET00000012649
Sequence length 294
Comment pep:novel supercontig:Nleu1.0:GL397365.1:3197273:3198265:-1 gene:ENSNLEG00000009908 transcript:ENSNLET00000012649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSRGRPGPETDLLAVAEHQAPIFGGGPGRTSSEPPSGLRVSGEEEAENVGGANRHPRT
SPKTSSCGVVHRPEREALENEPGPSRTPSGAGSRRGRWRLQDSRSLDGLSEACGGAGSSG
SAESGAGGGRRATISSPLELEGTVSRHGDLTHFVANNLQLKIRLSGAPPPPPSAPVRPCP
GPAPTPTPAIPPIDPEVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDA
VDSLGEAVDMSIKGMYTLLARCEELERALQPVQGLARQVRDIRRTLEVLEALCK
Download sequence
Identical sequences ENSNLEP00000012060 ENSNLEP00000012060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]