SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012150 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012150
Domain Number 1 Region: 400-618
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.23e-51
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 609-739
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000685
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012150   Gene: ENSNLEG00000009965   Transcript: ENSNLET00000012745
Sequence length 841
Comment pep:novel supercontig:Nleu1.0:GL397365.1:3311444:3323421:1 gene:ENSNLEG00000009965 transcript:ENSNLET00000012745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQSLPAATPPTQKPPRIIRPRPPSRSRAAQSPGPPHNGSSPQELPRNSNDAPTPMCAP
IFWEPPAASLKPPALLPPSASRASLDSQTSPDSPSSTPTPSPVSRRSASPEPAPRSPVPP
PKPSGSPCMPLLPMAGVLAQNGSASAPGTVRRLAGRFEGGAEGRAQDADAPEPSLQVRAD
VNGEREAPLTGSGSQENGAPDAGLACPPCCPCICHTTRPGLELRWVPVGGYEEIPRVPRR
ASPLRTSRSRPNPPSIGHPAVVLTSYRSTAERKLLPPLKPPKPTRVRQDATIFGDPPEPD
LDLPSEDGIQTGDSPDEAPRNAPPATVEGREEEGLEVLKEQNWELPLQDEPLYQTYRAAV
LSEELWGVGEDGSPSPANAGDAPTFPRPPGPRNTLWQELPAVQASGLLDTLSSQERRMQE
SLFEVVTSEASYLRSLRLLTDTFVLSQALRDTLTPRDHHTLFSNVQRVQGVSERFLATLL
SRVRSSPHISDLCDVVHAHAVGPFSVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQS
LPKCERLPLPSFLLLPFQRITRLRMLLQNILRQTEEGSSRQENAQKALGAVSKIIERCSA
EVGRMKQTEELIRLTQRLRFHKVKALPLVSWSRRLEFQGELTELGCRRGGVLFASRPRFT
PLCLLLFSDLLLITQPKSGQRLQVLDYAHRSLVQAQQVPDPSGPPTFRLSLLSNHQGRPT
HRLLQASSLSDMQRWLGAFPTPGPLPCSSDTIYEDCDCSQELCSESSAPAKTEGRSLESR
AAPKHLHKTPEGWLKGLPGAFPAQLVCEVTGEHERRRHLRQHQRLLEAVGPSSGTPNAPP
P
Download sequence
Identical sequences G1RG00
XP_003274701.1.23891 XP_012356801.1.23891 ENSNLEP00000012150 ENSNLEP00000012150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]