SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012178 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012178
Domain Number 1 Region: 304-501
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.75e-46
Family CRAL/TRIO domain 0.0000302
Further Details:      
 
Domain Number 2 Region: 220-303
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 5.89e-22
Family CRAL/TRIO N-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 509-667
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 2.75e-18
Family Supernatant protein factor (SPF), C-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012178   Gene: ENSNLEG00000009992   Transcript: ENSNLET00000012774
Sequence length 696
Comment pep:novel supercontig:Nleu1.0:GL397322.1:4866889:4919390:1 gene:ENSNLEG00000009992 transcript:ENSNLET00000012774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQRYQSPVRVYKYPFELVMAAYEKRFPTCPQIPVFLGSEVLRESRSPDGAVHVVERSCR
LRVDAPRLLRKIAGVEHVVFVQTNVLNWKERTLLIEAHNETFANRVVVNEHCSYTVHPEN
EDWTCFEQSASLDIRSFFGFENALEKIAMKQYTANVKRGKEVIEHYLNELISQGTSHIPR
WTPAPVREEDARNQAGPRDPGSLEAHGPSSTLRPALEAVSMDGDKLDADYIERCLGHLTP
MQESCLIQLRHWLQETHKGKIPKDEHILRFLRARDFHLDKAREMLRQSLSWRKQHQVDLL
LQTWQPPALLEEFYAGGWHYQDIDGRPLYILRLGQMDTKGLMKAVGEEALLRHVLSVNEE
GQKRCEGSTRQLGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLL
IVRAPRVFPVLWTLISPFINENTRRKFLIYSGSNYQGPGGLVDYLDREVIPDFLGGESVC
NVPEGGLVPKSLYMTEEEQERTDQLWQWSETYHSATVLRGAPHEVAVEILEEESVITWDF
DILRGDVVFSLYHTKQVPRLGAREPGTRASGQLIDKGWVPGRDYSRVEAPLVCREGESIQ
GSHVTRWPGVYLLQWQMHSPPGSVACSLPGVDDVLTALHSPGPKCKLLYYCEVLASEDFR
GSMSSLESCTSGFSQLSAATSSSSSGQSHSSSLVSR
Download sequence
Identical sequences G1RG28
ENSNLEP00000012178 ENSNLEP00000012178 XP_003269289.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]